KEGG   Actinoplanes sp. SE50/110: ACPL_4850Help
Entry
ACPL_4850         CDS       T02044                                 

Gene name
xlnB
Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ase  Actinoplanes sp. SE50/110
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5281561..5282550
Genome map
AA seq 329 aa AA seqDB search
MPDAPTSSRPRARLKATLAAACTVVAAVAGTMLASSPAHADTTVSSNQTGTNNGYYYSFW
KDSGNVSMTMGAGGQYSTQWSSVNNFVAGKGWSTGARRAVSYSGSFNPSGNAYLSLYGWT
TSPLVEYYIVDNWGTYRPTGTYMGTVTSDGGTYDIYRTQRVNQPSIQGTATFYQYWSVRQ
SKRTGGTITTGNHFDAWASKGMNLGTFNYQILATEGYQSSGNSNITVGGTGGSTGGGGST
GGGCTATLSAGQQWSDRYNLNVTVSGSSNWTVTLNIPSPAKSIATWNTAASYPSAQTLVA
KPNGSGNTFGVTIQANGNWTWPNVSCSGS
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgctcccacgtcatcccgtccccgggcccggctcaaagccaccctcgccgcc
gcctgcacggtggtcgccgccgtcgccggcaccatgctggccagcagcccggcgcacgcc
gacaccaccgtcagcagcaatcagaccggcaccaacaacggctattactactcgttctgg
aaggacagcggcaacgtcagcatgaccatgggcgccggcggtcagtacagcacccagtgg
agcagcgtgaacaacttcgtcgccggcaagggctggtcgaccggggcgcgccgcgcggtc
tcctactcggggtcgttcaatccgagcggcaacgcctatctttcgctgtacgggtggacc
accagcccgctcgtcgagtactacatcgtcgacaactggggcacctaccgcccgaccggc
acctacatgggcacggtgaccagcgacggcggcacgtacgacatctatcgcacgcagcgc
gtcaaccagccgtcgatccagggcacggccacgttctaccagtattggagtgtccggcag
tcgaagcggaccggcggcaccatcacgaccggcaaccatttcgacgcctgggcgtccaag
ggcatgaacctcggcaccttcaactaccagatcctggcaaccgagggctaccagagcagc
gggaattcgaacatcaccgtgggcggcacgggcggcagcaccggcgggggtggaagcacc
ggcggcgggtgcaccgccacgctctccgccggccagcagtggagtgaccgctacaacctc
aacgtcaccgtctccgggtccagcaactggacggtcacgctgaacatcccgtccccggcc
aagagcatcgccacctggaacaccgcggcgagttacccgagcgcgcagaccctggtcgcc
aagccgaacggcagcggcaacaccttcggcgtcaccatccaggcgaacgggaactggacg
tggcccaacgtttcgtgcagcgggagctga

DBGET integrated database retrieval system