KEGG   Actinoplanes sp. SE50/110: ACPL_4941Help
Entry
ACPL_4941         CDS       T02044                                 

Gene name
abfB
Definition
arabinofuranosidase (EC:3.2.1.55)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ase  Actinoplanes sp. SE50/110
Brite
Enzymes [BR:ase01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     ACPL_4941 (abfB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5381730..5384060
Genome map
AA seq 776 aa AA seqDB search
MLIGGVVAVVAVAGSVVVSAGASAAASTLGAAAAQSGRYFGTALAAGRLGDATYTGIAGR
EFTMVTPENEMKPDATEPQRGQFTFSAGDQIYNWATQHGMKVRGHTLAWHGQQPGWMQSL
SGSSLRQAMIDHINGVMAHYKGKLAAWDVVNEAYNEDGSRRQSNLQGTGNDWIEVAFRTA
RAADPSVKLCYNDYNIENATYAKTLAVLTMVKDFKSRGVPIDCVGLQTHFTGGSALPGNF
QTTLTNFANAGVDVALTEADVTNASTSQYAGLTQACVNVPRCLGVTVWGVRDSDSWRSSE
NPLLFDGSGTKKAAYTSVLDALNAAGPTPSGSSTPPSGTGEIRGTQSGRCIDVPNRSQTD
GTRVTLYDCNRGTNQQWTYTSNRQLTVYGTKCLDAAGSGNSAAIQIYSCNGQANQQWNVN
ANGTITGVQSGRCLDVWGTANGQQVQLYDCNGQANQQFTYSAPGTSSPTPSPSGSTCTLP
SSYRWSSTGALAQPKNGWTSLKDFTNVVYNGKHLVYASNVSNGSYGSMNFTPFTNWSDMA
SAGQNGMSQGTVAPTLFYFAPKNIWVLAYQWGPTSFSYKTSTDPTNANGWSSAQTLFTGT
LPDAPYGVIDQTLIGDDQNMYLFFAGDNGKIYRASMPIGNFPGSFGSSYTTVMSDSTNNL
FEAVEVYKVQGQNQYLMIVEAIGSQGRYFRSFTASSLGGSWTPQAASESNPFAGTANSGA
TWTNDISHGDLVRENPDQTKTVDPCHLQLLYQGKDPNAGGDYNNLPWRPGLLTLQR
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgctcatcggcggtgtcgtcgcggtcgtcgcggtggcgggttcggtggtggtcagcgcc
ggcgcgagtgcggcggcgagcaccctcggcgccgcggccgcccagtcgggccgctacttc
ggcaccgccctcgcggcggggcggctcggcgatgcgacgtacaccggcatcgcgggacgc
gaattcaccatggtgacccccgagaacgagatgaagccggacgcgacggaaccgcagcgc
ggccagttcactttcagcgccggcgaccagatctacaactgggcgacccagcacggcatg
aaggtccgcggccacaccctggcctggcacggccagcaacccggatggatgcagagcctc
agcggcagctcgctgcgtcaggccatgatcgaccacatcaacggcgtgatggcgcactac
aagggcaagctggccgcctgggacgtggtcaacgaggcgtacaacgaggatggcagccgc
cggcagtcgaatctgcagggcaccggcaacgactggatcgaggtggcgttccgcacggcg
cgggccgccgatccgtcggtcaagctctgctacaacgactacaacatcgagaacgcgacg
tacgccaagaccctggccgtgctcaccatggtcaaggacttcaagtcgcgcggcgtgccg
atcgactgcgtcgggctgcagacccacttcaccggcggcagtgcgctgcccggcaacttt
cagaccacgctcaccaacttcgccaacgccggcgtggacgtcgcgctgaccgaggccgac
gtcaccaacgcgtccacctcgcagtacgccgggctcacccaggcttgcgtcaacgtgccg
cgctgcctgggcgtcaccgtgtggggtgtgcgggacagcgactcgtggcggtcgagtgag
aacccgctgctgttcgacggttcgggcaccaagaaggccgcctacacctcggtcctcgac
gcgctcaacgccgccggccccaccccgagcggcagctccaccccgccgagcgggacggga
gagatccggggaacccagtcggggcggtgcatcgacgtaccgaaccggtcgcagaccgac
ggcacccgcgtgacgctctacgactgcaaccgcggcaccaaccagcagtggacgtacacg
tcgaacaggcagctgacggtgtacggcaccaagtgcctggacgccgccggctccggcaac
tccgcggcgatccagatctacagctgcaacgggcaggccaaccagcagtggaacgtcaac
gccaacgggaccatcaccggcgtgcagtccggccgctgcctggacgtctggggcaccgcc
aacggccagcaggtccagctgtacgactgcaacggccaggccaaccagcaattcacctac
tccgcccccggcaccagctcgccgacgccgtcgccgagcggcagcacctgcacgctgccg
tcgtcgtaccgctggagctcgacgggtgcgctcgcgcagccgaagaacggctggacctcg
ctgaaggacttcaccaacgtcgtctacaacggcaagcacctggtgtacgcgtccaacgtg
tccaacgggtcgtacggctcgatgaatttcaccccgttcaccaactggtcggacatggcc
tcggccgggcagaacgggatgagccagggcaccgtggcgcccaccctcttctacttcgcg
ccgaagaacatctgggtgctggcctaccagtgggggccgacgtcgttcagctacaagacc
tccaccgacccgaccaatgccaacggctggtccagcgcgcagaccctgttcaccggaacg
ctgcccgacgcgccgtacggggtgatcgaccagacgctgatcggtgacgaccagaacatg
tacctgttcttcgccggggacaacggcaagatctaccgggcgagcatgccgatcggcaac
ttcccgggcagcttcggctcctcgtacaccacggtcatgagcgactcgaccaacaacctg
ttcgaagcggtcgaggtctacaaggtccagggacagaaccagtacctgatgatcgtcgag
gcgatcggcagtcagggccgctacttccggtcgttcaccgcgagcagcctcggcggctcc
tggaccccgcaggccgccagcgagagcaacccgttcgccggcacggccaacagcggcgcc
acctggaccaacgacatcagccacggggacctggtccgggagaatccggaccagaccaag
accgtcgacccgtgccacctgcaattgctctatcagggcaaggaccccaacgccggcggc
gactacaacaacctgccgtggcgtccgggcctgctcaccctgcagcgctga

DBGET integrated database retrieval system