KEGG   Actinoplanes sp. SE50/110: ACPL_5158Help
Entry
ACPL_5158         CDS       T02044                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACPL_5158
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACPL_5158
   00630 Glyoxylate and dicarboxylate metabolism
    ACPL_5158
Enzymes [BR:ase01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ACPL_5158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5628252..5629874
Genome map
AA seq 540 aa AA seqDB search
MGAEEITITGTTADRYSEILTPEAVAFVVALDREFGARRVQLLERRRRRRATRTTDLDFL
PSTRAIRDDASWQVAAPAADLRDRRVEITGPPERKMTINALNSGAKVWMADFEDATSPTW
ENVILGQVNLKDALDGTLDWTAPDGRRYEVGADLPTIMVRPRGWHLPECHLRIGGRAVSA
SLFDFGLYLFHCGQRQIDRGSGPYFYLPKLESHLEARLWNDVFVFAQEQLGIPRGTIRAT
VLIETINAAFEMDEILYELREHSAGLNAGRWDYLFSMIKNRPDVVLPERSQVTMTAPFMR
AYTELLVKTCHRRGAHAIGGMAAVVPSRDPVAAKRALNQVRQDKRREVGDGFDGSWVAHP
ALVETCREVFDQWLGDEPHQIVRKRDDVRVGAAELLDVKATAVAVGEVALRNNISVSLRY
IASWLGGRGAVALGGLMEDAATAEICRAQLWQWISSGTPTDYGVPVTAAMVTRMLREELD
VLSETGALDEEAARLFGQARTLLTVLLTERTCPEFLTLPAYLRHLSGGSAPVVTRATVAA
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccgaagagatcaccatcaccggaaccaccgcagaccgatactccgagattctg
acccccgaggccgtcgcgttcgtggtggcactggaccgggagttcggtgcccggcgggtg
cagctgctggagcgccgccggcgccgccgggccacccgcaccacggacctggacttcctg
ccctccacccgggccatccgcgacgacgcgtcgtggcaggtggcggccccggccgcggac
ctgcgcgaccgccgcgtcgagatcaccggcccgcccgagcgcaaaatgaccatcaacgcg
ctgaactccggcgccaaggtctggatggccgacttcgaggacgccacctctcccacctgg
gagaacgtgatcctcggccaggtcaacctgaaggacgcgctggacggcactctcgactgg
acggcccccgacggccgccggtacgaggtgggcgccgacctgcccaccatcatggtccgc
ccgcgcggctggcacctgcccgagtgccacctgcggatcggcggccgcgcggtctccgcg
tcgctgttcgacttcggtctgtacctgttccactgcgggcagcggcagatcgaccggggt
tccggcccgtacttctacctgccgaagctggagtcgcacctggaggcccgcctctggaac
gacgtcttcgtcttcgcccaggagcagctcggcatcccgcgcggcacgatccgggccacc
gtgctgatcgagacgatcaacgcggccttcgagatggacgagatcctctacgagctgcgc
gagcactcggcgggtctcaacgccggccgctgggactacctgttcagcatgatcaagaac
cggccggacgtggtcctgcccgagcggtcccaggtcaccatgaccgcgccgttcatgcgg
gcctacaccgaactgctggtcaagacgtgccaccggcgcggtgcccacgcgatcggcggg
atggccgcggtcgtccccagccgtgacccggtcgccgccaagcgtgccctcaaccaggtc
cgccaggacaagcgccgcgaggtcggcgacggcttcgacggctcctgggtggcgcacccc
gcgctggtcgagacctgccgcgaggtcttcgaccagtggctcggcgacgagccgcaccag
atcgtccgcaagcgcgacgacgtgcgggtcggcgccgcggaactcctcgatgtgaaggcc
accgcggtcgccgtcggcgaggtcgcgctgcgcaacaacatcagcgtctcgctgcgttac
atcgcctcctggctgggcggccgcggcgcggtcgcgctcggcggactcatggaggacgcc
gccaccgcggagatctgccgggcccagctctggcagtggatctcgtcgggcacccccacc
gactacggcgtcccggtcacggccgccatggtcacccggatgctccgcgaggagctggac
gtgctcagcgagaccggtgcgctggacgaggaggcggcccggctcttcggccaggcccgc
acgctcctcacggtcctgctcaccgaacggacgtgcccggagttcctgaccctgccggca
tacctacggcacctgtcgggcgggtcggctccggtcgtcacgagggctactgtcgcggcc
tga

DBGET integrated database retrieval system