KEGG   Actinoplanes sp. SE50/110: ACPL_5304Help
Entry
ACPL_5304         CDS       T02044                                 

Gene name
chlI
Definition
(GenBank) magnesium chelatase subunit D
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00860  Porphyrin and chlorophyll metabolism
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACPL_5304 (chlI)
Enzymes [BR:ase01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ACPL_5304 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 VWA Mg_chelatase AAA_5 MCM Sigma54_activat AAA_16 VWA_3
Motif
Other DBs
NCBI-ProteinID: AEV86191
UniProt: G8S5I9
Position
complement(5785210..5787315)
Genome map
AA seq 701 aa AA seqDB search
MTTPYPFSAVVGLDDLRLALLLTSVSPAVGGVLVRGEKGTAKSTVVRALAGLLPPVTVVR
GCRFACDPAAPDPDCPDGPHPADTPAGHRAATLVELPVGATEDRVVGTLDIQRALADGVK
AYEPGLLAAAHRGVLYVDEVNLLPDHLVDLLLDAAAMGRAHVERDGVSVKHAARFLLVGT
MNPEEGEPRPQLVDRFGLVVTVAAPRDARLRAEVVRRRLAYELDPAGFAARFADDEREYA
ARIAAARALLPSVTLPDAELDRIARICLAYGVDGMRADIVVARCAVAMAAWHGRDVVTAT
DVADAARLALPHRRRTDPLDPPGTDEEKLDQALAEAERQAQDEAGRQAQQEAERQAREDD
GGPDGDGPDDTPDGGPRDGGPDDGGPGPDGGGPGGGPAGDPPPGPPSSSAPPTEAPASDG
GSPDTPAVGDGPAAAPAGPAFRPRTLRINARGEGGHTGKRSPAYARRGRVVGSRKPLGRL
AGAPHLPATLRAALHRTALHGGPARTTGVEPRDLREAIHVGREANLVLFVVDASGSMAAR
KRMTLVKTAVLSLLRDAYQRRDRIGMITFRGADADVVLPPTSSHEVGVMRLAALRTGGRT
PLAAGLRAAARTVATERRRDPRRRPLLIVVTDGRATSGPDPLRLAPALTGVATVVVDCES
GPIRLGLARRLAAALGADVMPLDELEAATARSAERGYRHAA
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
gtgactactccgtacccgttctcggccgtggtcggcctggacgatctgcgcctcgcgctg
ctgctgacctcggtgtcgccggcggtgggcggcgtcctggtccgcggtgagaaggggacc
gccaagagcaccgtggtccgggcgctggccgggctgctgccgccggtgacggtggtgcgc
ggctgccggttcgcctgcgaccccgccgcgcccgacccggactgtccggacgggccgcat
cccgcggacacgccggccgggcaccgggcggcgacgctggtcgagctgccggtgggggcg
accgaggaccgggtggtcggcaccctcgacatccagcgcgcgctggccgacggggtgaag
gcgtacgagccggggctgctcgccgccgcccaccggggcgtcctctacgtggacgaggtc
aacctgctgccggaccacctggtggacctgctgctggacgcggccgcgatgggccgcgcg
cacgtggagcgggacggggtctcggtcaagcacgcggcgcggttcctgctggtgggcacg
atgaacccggaggagggcgagccgcggccgcagctggtggaccggttcgggctggtggtc
acggtggcggcgccgcgggatgcgcggctgcgggccgaggtggtgcgccggcggctggca
tacgagctggatccggccgggttcgcggcccgtttcgccgacgacgagcgggagtacgcg
gcccggatcgccgccgcgcgagccctcctgccgagcgtgaccctgccggacgcggagctc
gaccggatcgcccggatctgcctcgcctacggggtggacgggatgcgcgcggacatcgtc
gtggcccgctgcgcggtggcgatggccgcctggcacgggcgcgacgtggtcaccgccacc
gacgtcgccgacgccgcccgcctggccctgccgcatcgccgccgcaccgatccgctcgac
ccgccgggcaccgacgaggagaagctcgatcaggccctggccgaggcggagcgtcaggct
caggacgaggcggggcgtcaggctcagcaggaagcggaacgtcaggcccgggaggacgac
ggcggccccgacggtgacgggccggacgacaccccggacggcggcccgcgcgacggcggc
ccggacgacgggggcccgggtccggacgggggtggtcccggtggcggtccggccggtgac
ccgccgcccggccccccgagcagcagcgcgccaccgaccgaggcgccggcatcggacggc
gggtcaccggacaccccggccgtcggcgacgggccggcggcggctccggccgggccggcg
ttccgaccccgcacgctgcggatcaacgcccggggcgagggtgggcacaccggcaagcgg
tcccccgcctacgcccggcggggccgggtcgtcggctcccgcaagccgctgggccgactg
gccggcgccccgcacctcccggccaccctccgcgccgccctgcaccggaccgcgctgcac
ggcggaccggcccggacaacgggggtcgaaccgcgggatctgcgcgaggcgatccatgtc
ggccgggaggcgaacctggtgctgttcgtcgtggacgcgtccgggtcgatggccgcgcgc
aaacggatgaccctggtcaagaccgcggtgctgtccctgctgcgggacgcctaccagcgc
cgcgaccggatcgggatgatcacgttccggggcgccgacgcggacgtggtgctgccaccc
acgtccagccacgaggtcggggtcatgcggctcgccgcgctgcggaccggcgggcggacc
ccgctggcggccggcctgcgcgcggcggcccggaccgtcgcgaccgaacgccgccgggat
ccgcgccggcgtccgctgctgatcgtggtcaccgacgggcgggccaccagcgggcccgat
ccgctgcggctggcaccggcgctgaccggggtcgcgacggtggtcgtcgactgcgagtcc
gggccgatccggctggggctggcccgccggctggccgccgctctgggcgccgacgtcatg
ccgctcgacgagttggaggcggcgaccgcccggtcggcggagcgcggctaccgccacgcc
gcctga

DBGET integrated database retrieval system