KEGG   Actinoplanes sp. SE50/110: ACPL_5485Help
Entry
ACPL_5485         CDS       T02044                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ase00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ACPL_5485 (recD)
Enzymes [BR:ase01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ACPL_5485 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5991968..5994166
Genome map
AA seq 732 aa AA seqDB search
MVAMPAAQQTSRPAPHVLEAVLERLTYVNEETGYTVARVATAKSGSDLLTVVGALLGAQP
GESLRLSGWWSSHPQYGRQFEVVSYTTVLPATIQGIRRYLGSGLVKGIGPVFAERIVEHF
GLDTLEIIETSPDRLIEVTGLGPKRTAKITAAWAEQKAIKEVMVFLQGVGVSTSIAVRIY
KKYGDSSISVVRNSPYRLASDVWGIGFKTADTIAQAVGIPHDSPERVKAGLQYTLSQATD
NGHCFLPVDQLTDEASRILEVPAGLIPRCLDELVEEEGVVREDDHVYLVPFHRAEISLAA
TLVRLLHDRSDRMPHFGDVDWAKALDWLHRRTGNTLAPEQEAAVKLALTHKVAVLTGGPG
CGKSFTVRSIVELAAAKRARIQLVAPTGRAAKRLAELTGHPAATVHRLLKLQPGGDASFD
RDNPLDADLLVVDESSMLDLILANKLVKAIPPGAHLLLVGDVDQLPSVGAGEVLRDLLAA
EVIPRVRLTQIFRQAAESGVVTNAHRVNRGRPPLLDGMSDFFLFPCDDTEETAGLTVDVA
CQRIPRRFGLDPRRDVQILTPMHRGPAGAGALNTLLQQQLTPAREDLPERRAGGRVFRVG
DKVTQIRNNYDKGVAGVFNGTVGVITGLSPEEQTLTVRTDEDELIEYDFDELDELAHAYA
ITIHRSQGSEYPAVVIPLTTSAWMMLQRNLLYTAITRAKRLVVLVGSRKALAAAVRTVGA
GRRHTALAERLG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccatgcccgccgcgcaacagacctcccggccggcgccgcacgtgctggaagcg
gtgctggagcggctgacctatgtgaacgaggagaccggctacacggtggcccgggtggcc
accgcgaagagcggatcggacctgctcaccgtggtgggcgcactgctcggcgcgcagccc
ggggagagtctgcggctgtccggctggtggagttcgcacccgcagtacgggcggcagttc
gaggtggtctcgtacaccaccgtgctgccggcgaccatccagggcatccgccgctacttg
ggatcggggctggtcaaggggatcggtccggtcttcgccgagcggatcgtggagcacttc
gggctggacacgctggagatcatcgagacgtcaccggaccggctgatcgaggtgaccggg
ctgggtccgaaacggaccgcgaagatcaccgcggcgtgggccgagcagaaggcgatcaag
gaggtgatggtcttcctccagggggtgggggtgtccacctcgatcgcggtgcggatctac
aagaagtacggcgactcgtcgatctcggtggtgcgcaacagcccgtaccgactcgcctcg
gacgtctggggtatcggcttcaagacggcggacacgatcgcgcaggcggtcgggattccg
cacgacagtccggagcgggtgaaggccggcctgcagtacacgctgtcccaggcgaccgac
aacggtcactgtttcctgccggtcgaccagctgaccgacgaggcgtccaggattctcgaa
gtcccggccggactcatcccgcgatgtctcgatgagctggtcgaggaggagggcgtggtc
cgcgaggacgaccacgtctacctggtcccgttccaccgtgccgagatctccctcgccgcc
accctggtccggctgctgcacgacaggtcggacaggatgccgcacttcggtgacgtcgac
tgggccaaggcactcgactggctgcaccggcgcaccgggaacaccctcgcgcccgagcag
gaggccgcggtcaagctggcgctcacccacaaggtcgcggtcctcaccggcggcccgggc
tgcggcaagagcttcaccgtccgctccatcgtcgaactcgccgccgccaaacgcgccagg
atccagctggtcgcacccaccggccgggccgccaaacggctcgccgagctgaccgggcat
cccgcggccaccgtgcaccggctgctcaagctgcagcccggcggcgacgccagcttcgac
cgggacaatccgctcgacgccgacctgctggtcgtcgacgagtcctcgatgctcgacctg
atcctggcgaacaagctggtcaaggcgatcccgccgggcgctcacctgctgctggtcggg
gacgtcgaccagctcccgtcggtgggcgccggcgaggtgctgcgggacctgctcgcggcg
gaggtgatcccccgcgtacggctgacgcagatcttccggcaggccgcggagagcggcgtc
gtcacgaacgcccaccgggtcaaccgcggacgcccgccgctgctcgacgggatgagcgac
ttcttcctgttcccgtgcgacgacaccgaggagaccgcgggcctcacggtggacgtcgcg
tgccagcggatcccccgccggttcggcctcgacccgcgccgcgacgtgcagatcctcacc
ccgatgcaccgcgggccggccggtgccggcgcgctcaacacgctgctgcagcagcagctc
accccggcccgcgaggacctgccggagcggcgggccggcgggcgggtcttccgggtcggc
gacaaggtcacccagatccgcaacaactacgacaagggggtggcgggggtcttcaacggc
acggtcggcgtcatcaccgggttgtcgcccgaggagcagaccctgacggtacggacggac
gaggacgaactgatcgagtacgacttcgacgaactggacgagctggcccacgcctatgcg
atcaccatccaccggtcgcagggttcggagtatccggcggtggtgatcccgctgaccacc
agcgcgtggatgatgctgcagcgcaacctgctctacaccgcgatcacccgggcgaagcgg
ctggtggtgctggtcggctcgcgcaaggcgctggccgcggcggtgcgcacggtcggcgcc
ggccgccggcacaccgcgctcgccgaacgcctcggctag

DBGET integrated database retrieval system