KEGG   Actinoplanes sp. SE50/110: ACPL_5525Help
Entry
ACPL_5525         CDS       T02044                                 

Gene name
choD
Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
ase  Actinoplanes sp. SE50/110
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    ACPL_5525 (choD)
Enzymes [BR:ase01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     ACPL_5525 (choD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6037208..6038884)
Genome map
AA seq 558 aa AA seqDB search
MSFDYDVLIIGSGFGGSVSALRLTEKGYRVGVLEAGRRFADEQFAKTSWRLRDYVYAPAL
GCYGILRLTLLKNVLIMSGAGVGGGSLGYANTLYEPPDAFFADPQWAAITDWKRELGPYY
DQARRMLGVITNPVETDADRALRAVAEDLGVGHTYRRTPVGVFFGRDGSEPGAEAPDPFF
GGAGPARRGCTLCGSCMTGCRGNAKNTLVKNYLYLAERAGARVHELTTVRNVRPLPGGGY
AVATRRTGGLRRSTLTARQVIFAAGALGTQRLLHRLRDRGSLPAVSPRLGELSRTNSESI
LGARTRRRDRDYSHGVAITSSIHPDPVTHVEPVRYGPGSNLLALLSTVLVDDTGRGPRWW
AGLRQLATAGRDLRLYLSPRDWSRQTVVLLAMQPLDNSITVFRRRGRLTSRPGVGEPNPA
WVPAAHEVARRTAEKVDGVPLGSYTAWVGKPVTGHFIGGCAIGADPESGVVDPYHRLFGH
PGLHVIDGSVVAANLGVNPSLTITALAERAVALWPNNGEEDTRPPIGHGYLGIGPTAPVR
PAVPPSAPGALRFPGVAR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgactacgacgtcctcatcatcgggtccgggttcggcggcagcgtgagcgcg
ctgcggctgaccgagaagggctaccgggtgggcgtcctcgaggccggtcgccggttcgcc
gacgagcagttcgccaagacgtcctggcggctgcgcgactatgtctacgcgccggccctc
ggctgttacgggatcctccggctgaccctgctcaagaacgtcctgatcatgtcgggcgcc
ggcgtgggcggcggctcgctcggctatgcgaacacgctctacgagccgccggacgcgttc
ttcgccgacccgcagtgggcggcgatcaccgactggaagcgcgagctcgggccctactac
gaccaggccaggcggatgctcggcgtgatcacgaacccggtggagaccgacgcggatcgg
gctttgcgagccgtggcggaggatctcggcgtcgggcacacctatcggcgtacccccgtg
ggcgtgtttttcggccgggacggcagcgaacccggcgccgaggcgccggacccgttcttc
ggcggcgccggaccggcccggcgcggctgcacactgtgcggctcgtgcatgaccgggtgc
cgcggcaacgccaagaacaccctggtcaaaaactatctgtacctggccgagcgggccggc
gcgcgggtccacgagctgaccacggtgcgtaacgtgcggccgctgcccggcggtggctac
gcggtcgccacccggcgcaccggcgggctgcggcggtccaccctcaccgcccggcaggtg
atcttcgcggccggggcgctcggcacccagcggctgctgcaccggttgcgcgaccggggc
agcctgcccgcggtctcgccgcggctcggcgagctgagccgcaccaactccgagtcgatc
ctgggcgcgcgcacccggcgccgggaccgcgactacagccacggcgtcgcgatcacctcg
tcgatccacccggacccggtgacccatgtcgagccggtccgatacggcccgggcagcaac
ctgctcgcgctgctgtccaccgtgctggtcgacgacaccggccgcggcccgcgctggtgg
gccggcctgcggcaactcgccacggccgggcgcgacctgcgtctgtatctgtcgccgcgg
gactggtcgcggcagaccgtggtgctgctcgccatgcagccgctggacaattcgatcacc
gtcttccgccgccggggacggctcaccagccgacccggggtgggcgagccgaaccccgca
tgggttccggccgcgcacgaggtggcccgccggaccgcggaaaaggtggacggggtgccg
ctcgggtcgtataccgcatgggtgggcaagccggtgaccggtcatttcatcggcggctgc
gcgatcggcgccgacccggagtccggcgtggtcgatccgtatcatcggctgttcgggcat
cccggcctgcacgtgatcgacggatcggtggtggccgccaatctgggtgtcaacccgtcg
ctgacgatcaccgcgctggccgaacgcgcggtcgcgctgtggcccaacaacggcgaagag
gacacccgcccgccgatcggtcacggttatctcggcatcggtccgacggcgccggtacgc
cccgccgtgccaccgtccgcacccggtgccctccgcttcccgggggtggcccgatga

DBGET integrated database retrieval system