KEGG   Actinoplanes sp. SE50/110: ACPL_5582Help
Entry
ACPL_5582         CDS       T02044                                 

Gene name
bga
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ACPL_5582 (bga)
Enzymes [BR:ase01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ACPL_5582 (bga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6107692..6109695)
Genome map
AA seq 667 aa AA seqDB search
MSDSPSDSPKMRNTTPRRWLRRAGAPRLEYGADYNPEQWPREVWAEDVRAMRAAGVTVVS
LAIFSWARIQPRPEVYDFAWLDEVVDLLYAGGIAVDLATATASPPPWLTARHPEILPVDK
HGNTVWPGGRQHWRPTSPVFRAHALRLVRALATRYGKHPAVVAWHVNNELGCHNVYDYSQ
DAALAFRSWLRERYRTLDGLNAAWGTDFWSQRYSDWDQIIPPRQAATHPNPTQNLDFKRF
SSDALKDHLIAERDLLRELSPDVPVTTNFMVMGETSAMNYADWASEVDFVSNDHYVVPHP
QARDELSFSANLTGNIAGGRPWFLMEHSTSAVNWQPVNLAKKPGELARDSLTHVAHGADA
VCFFQWRQSRAGAEKYHSAMLPHAGQDSELFRSVAALGERLAALESVAGTNRVPADVAIL
IDWDSWWVAEHDSHPTDRLRYRQEALDWYTALLDLGVRADVVPASSDFSGFTVVIAPVLH
VVPAALAARLNSFVTQGGHLVCTYFSGIVDENDQVWLGGYPGALRDLLGIRIEEFGPLLD
GETAELDNGTVGTLWTDRVDVTDPHVAVLARYKTGDQAERAAITRRAVGAGSAAYVSTRL
GPDGLAAVLPGLLQAAGVTSELAPELRGRVELARRARHRFLINRTAEPIDLGADGMLAGR
DVKIIQD
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattccccgagcgactccccgaagatgcggaacacgacgccccggcgctggctg
cgccgcgccggggcgccccggctggagtacggcgccgactacaaccccgagcagtggccg
cgcgaggtctgggccgaggacgtccgggcgatgcgcgcggccggtgtcaccgtcgtctcg
ctggcgatcttctcgtgggcgcggatccagccgcggcccgaggtttacgacttcgcctgg
ctggatgaggtcgtcgacctgctgtacgccggtggcatcgcggtcgacctggcgaccgct
accgcgtccccgccgccgtggctgaccgcccggcatccggagatcctgcccgtcgacaag
cacggcaacaccgtgtggcccggcgggcgccagcactggcggcccacctcgccggtcttc
cgggcgcacgcgttgcgcctggtccgggcactggccacccggtacggcaagcatccggcg
gtggtcgcctggcacgtcaacaacgagctgggctgccacaacgtctacgactactcacag
gacgcggcgctggcgttccggtcctggctgcgcgagaggtatcggacgctggacgggctc
aacgcggcgtggggcaccgacttctggtcgcagcgctactccgactgggaccagatcatc
ccgccgcggcaggccgccacccatccgaatccgacgcagaacctggacttcaaacgcttc
tcctcggacgcgctcaaggaccacctgatcgccgagcgcgacctgttgcgcgagctcagc
ccggacgtgccggtcaccacgaacttcatggtgatgggcgagaccagcgcgatgaactat
gccgactgggcgtccgaggtggacttcgtgtccaacgaccactacgtcgtgccgcatccg
caggcccgcgacgagctgtccttctcggccaacctgaccgggaacatcgcgggtggccgg
ccgtggttcctgatggagcactcgaccagcgcggtgaactggcagccggtgaacctggcg
aagaagccgggcgagctggcccgggactcgctgacccacgtggcgcacggcgccgacgcg
gtgtgcttcttccagtggcggcagtcgcgcgccggtgccgagaaataccactcggcgatg
ctgccgcacgccggtcaggacagtgagctgttccggtcggtggcggcgctgggggagcgg
ctggcggcactcgagtcggtcgcggggaccaatcgggtgccggccgacgtggcgatcctg
atcgactgggactcgtggtgggtggccgagcacgactcgcacccgaccgaccggctgcgg
taccgccaggaggcgctggactggtacacggcccttctggacctgggggtcagggccgac
gtcgtaccggcaagcagcgatttctccggcttcaccgtggtgatcgctccggtgctgcac
gtggtgccggcggcgctcgccgcgcgattgaactccttcgtcacccagggcggacatctg
gtctgtacgtatttttccggcatagtggatgagaacgatcaggtgtggctcggtggatac
cccggcgcgctgcgtgacctgctcggcatccggatcgaggagttcggcccgctgctcgac
ggggagaccgccgagctggacaacggcacggtcggcacgctgtggaccgaccgggtcgac
gtcaccgatccacacgtggcggtcctggcccggtacaagaccggtgaccaggcggaacgt
gccgcgatcacccggcgtgcggtgggcgccggctccgcggcctacgtctccacccggctc
ggcccggatggtctggccgcggtgctgcccggtctgctccaggccgccggagtgaccagc
gaactcgctcctgagctgcgcggacgtgtcgagctggcgcgccgggccaggcaccgattc
ctgatcaaccggaccgccgaaccgatcgacctgggcgcggacggcatgctggccggccgc
gacgtgaaaatcattcaggattga

DBGET integrated database retrieval system