KEGG   Actinoplanes sp. SE50/110: ACPL_5629Help
Entry
ACPL_5629         CDS       T02044                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ase00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6156602..6158098
Genome map
AA seq 498 aa AA seqDB search
MTERYVVAIDQGTTSTRCIVFDRRGQLVSLAQQEHKQHFPRPGWVEHDAMEIWRNVERLA
PRALRRAGITLDQVAAVGIANQRETTVIWDRLTGIPVGRAIIWQDTRTDALVHSLSSSPL
SPHVSDISGLPLATYFSAPRLRWMLDHTPGLQDRAERGEVLCGTMETWLIWNLTRGAHVT
DVTNASRTMLMDVHTLDWSDKALDFFGIPRAMLPEVRASIGAFGTACEAFPGVRIGAALG
DQQAALFGQTCFTPGEAKCTYGTGSFLLLNTGTELVRPGHGLLSTVAYQVAGSPACYALE
GSIAITGSLVQWFRDQLELISSAPEIETLARTVADNGGCYIVPAFSGLYAPHWRSEARGV
IVGLTSYITKGHLARAVLEATAWQTREVVDAMNATSGLALTTLKVDGGMTADNLLMQMIA
DVLDVPVVRPLAAETVSLGAAYAAGLAVGYWPDLDGLRRNWHIAGQWMPAMDPAVRNAEY
VNWQRAVQRTFDWIQPTP
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaacggtacgtggtcgccatcgaccaggggaccacctcgacccggtgcatcgtc
ttcgaccggcgcggccagctggtctccctggcccagcaggagcacaagcagcacttcccg
cggccgggctgggtggaacacgacgccatggaaatctggcgcaacgtggaacggctcgcg
ccgcgggcgctgcgccgggccgggatcacgctcgaccaggtggcggcggtggggatcgcc
aaccagcgggagacgacggtgatctgggaccggctcaccgggatcccggtggggcgggcg
atcatctggcaggacacgcggacggacgctctggtgcactcgttgtcctcgtcgccgctc
tccccccatgtctccgacatctcaggtctgccgctggcgacgtatttctccgcgccacgg
ctgcggtggatgctggaccatacgcccggattgcaggatcgtgcggaacgcggcgaggtg
ctctgcggcaccatggagacctggctgatctggaacctgacccgcggcgcgcacgtcacc
gacgtcaccaacgccagccgcaccatgctgatggacgtccacaccctcgactggtcggac
aaggcgctcgacttcttcggcataccgcgcgcgatgctgcccgaggtcagggcctcgatc
ggcgccttcggcaccgcttgcgaggcatttcccggcgtacgcatcggggccgcgctgggt
gaccagcaggcagccctgttcgggcagacgtgcttcacccccggcgaggcgaaatgcacg
tacggcaccgggagcttcctgctcctgaacaccggcaccgaactggtgcggccgggacac
ggcctgctcagcacggtggcctaccaggtggccgggtcgccggcctgctacgccctggaa
ggctcgatcgcgatcaccggatcactcgtgcaatggttccgcgaccagctcgaactcatc
tccagcgcacccgagatcgaaacgctggcacggaccgtggccgacaacggcggctgctac
atcgtgccggcgttctccgggctgtacgcgccgcactggcgctccgaggcgcgcggcgtg
atcgtggggctgacctcgtacatcaccaagggtcatctggcccgggcggtgctcgaagcg
accgcgtggcagacccgggaggtcgtcgacgcgatgaacgccacctccggcctcgcgctg
accaccctcaaagtggacggcgggatgaccgccgacaacctgctcatgcagatgatcgcg
gacgtgctcgacgtgccggtggtgcggcccctcgccgcggagacggtgtcgctgggcgcg
gcgtacgcggccgggctcgccgtcggatactggcccgacctggacggactgcggcgcaac
tggcacatcgccggacagtggatgccggcgatggacccggcggtgcgcaacgccgaatac
gtcaactggcagcgcgcggtgcaacggaccttcgactggatccagcccactccatga

DBGET integrated database retrieval system