KEGG   Actinoplanes sp. SE50/110: ACPL_5719Help
Entry
ACPL_5719         CDS       T02044                                 

Definition
pectinesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ase00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ase00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6257572..6258540)
Genome map
AA seq 322 aa AA seqDB search
MRRRTLLKIPALGAGAAVTVPHRPDLIIEPGDSVQAAIDAVATGVIGLRPGVYRGRVIVP
ADRIGLELRGLGRRPDDVVIADDRANGTLKPDGTPWGTSGSASVTVDGAGFRAVNLTFAN
LFDEAAHPEITNRQAVAVLTRADRLTFDRVRFLANQDTLYVNSTAAGVAARAYFRDCYVE
GDVDFIFGRATAVFDRCHLHSLDRGTSPDGYVTAPSTDAANPHGLLFAHCRFTSNAPPGT
VFLGRPWHPGNDPGATGQTIIRESWIGAHIGATGWSDFGSWPWRAARFAEYRNFGPGARC
GPDRPQLSRAEATSYDIEDFLW
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcggcgtaccctgttgaaaattcccgcactcggtgccggagcggccgtcacggtc
ccgcaccgaccggacctgatcatcgagccgggggacagcgtgcaggccgcgatcgacgcc
gtcgcgaccggggtgatcggcctgcgccccggtgtctaccgcggccgggtcatcgtgccg
gccgatcggatcggcctggaactgcgcggcctcgggcgccggccggacgatgtggtgatc
gccgacgaccgggccaacggcacgctcaaacccgacggcaccccctggggcacctccggc
agcgcctcggtcaccgtcgacggcgccggcttccgggcggtcaacctgaccttcgccaac
ctgttcgacgaggcggcccacccggagatcaccaaccggcaggcggtcgccgtgctgacc
cgcgccgaccggctcaccttcgaccgggtccggttcctggccaaccaggacaccctctac
gtgaacagcaccgcggccggggtggcggcccgcgcgtacttccgcgactgctacgtcgaa
ggcgacgtcgacttcatcttcggccgcgccaccgcggtgttcgatcgctgccacctccac
tcgctcgaccgcgggaccagtccggacggctacgtgaccgcgcccagcaccgacgccgcc
aacccgcacgggctgctgttcgcgcactgccggttcacctcgaacgcgccgcccggcacg
gtgttcctgggccggccctggcatcccggcaacgacccgggcgcgaccgggcagacgatc
atccgggagtcgtggatcggcgcccacatcggcgcgaccggctggagcgacttcggctcc
tggccctggcgggccgcccgcttcgccgaatatcgcaacttcgggccgggcgcgcggtgc
ggacccgaccggccacaactcagcagagccgaggccacgtcgtacgacatcgaggatttt
ctgtggtga

DBGET integrated database retrieval system