KEGG   Actinoplanes sp. SE50/110: ACPL_6037Help
Entry
ACPL_6037         CDS       T02044                                 

Definition
ricin B lectin (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ase00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ase00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ase00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6556178..6557755)
Genome map
AA seq 525 aa AA seqDB search
MRRLLIRSAVLLLGAGLISSVAASPAQALPNNLALTPPMGWNDWNAYGCNVSEALVKQTA
DKIVSAGLATAGYQYVNIDDCWMQKSRDAAGNLQPDLGKFPDGIAGTAAYVHGKGLKLGI
YEDAGTATCAGYPGSLGHEAQDARSFAAWGVDYLKYDNCNNSGSTTTAQYIARYSAMRDA
LAATGRPIVYSICEWGVNAPWTWAGDVGNLWRTTGDIQANYASMLSIFHQNVGLAAYAGP
GRWNDPDMLEVGNGMTATEDRAHFSLWAEMAAPLLAGNNLVTASATTLSILGNRSVIAVD
QDSAGRQGHLVSSTGGLDVLAKPLANGDVSVVLFNENAATATISTTVAAIGKSGASSYGL
ADLWAGTSGSTTGTISAGVPGHGVVMYRVSGGTTGGGTDTVVTIRGAGSGRCLDDPNSST
TNGTQVVIWDCNGGGNQRWTRVGNQLQVLGKCLDAYNNQTTNGTKVEIWDCNGQTNQQWT
VNADGTITGVQSGLCLDVTGAATANNTLVELWTCNGGSNQKWTLS
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccggctgctgatccggtcggcggtgctcctgctcggagcgggtttgatcagtagc
gtcgccgcctccccggcgcaggcgctgcccaacaatctggcgctcaccccgccgatgggc
tggaacgactggaacgcctacggctgcaacgtgtcggaggcgctggtcaaacagaccgcc
gacaagatcgtctcggcgggcctggcgaccgccggctaccagtacgtcaacatcgacgac
tgctggatgcagaagagccgcgacgcggccggcaacctgcagcccgacctcggcaagttt
cccgacggcatcgccggcaccgcggcgtacgtgcacggcaagggtctgaaactcggcatc
tacgaggacgccgggacggccacctgcgccggctacccgggcagcctcggacacgaggcg
caggacgcgcgctcgttcgccgcgtggggcgtcgactacctgaaatacgacaactgcaac
aacagcggctccaccaccaccgcgcagtacatcgcccggtactcggcgatgcgtgacgcg
ctggccgccaccggccggccgatcgtctacagcatctgcgagtggggggtgaacgcgccg
tggacctgggccggtgacgtcggcaacctgtggcgcaccaccggtgacatccaggcgaac
tacgccagcatgctgtcgatcttccaccagaacgtgggtctggccgcctacgccgggccc
ggccggtggaacgacccggacatgctggaggtcggcaacggcatgaccgccaccgaggac
cgcgcgcacttcagcctctgggccgagatggccgcgccgctgttggccggcaacaacctg
gtcaccgccagtgccaccacgctgtccatcctcggcaaccgctcggtgatcgcggtcgac
caggactccgccggtcggcagggtcacctggtcagctccaccggcgggctcgacgtactg
gccaaacccctcgcgaacggcgacgtgtcggtggtgctgttcaacgagaacgcggcgacc
gccacgatcagcaccacggtcgcggcgatcggcaagtccggggcgtccagctacgggctg
gccgacctgtgggccggaaccagcggcagcaccaccgggacgatcagcgccggcgtcccc
gggcacggcgtggtcatgtaccgggtgtccggcggcaccaccggcggcggcaccgacacc
gtcgtcaccatccgcggcgccggctcgggccgctgcctggacgacccgaacagcagcacc
accaacggcacccaggtggtcatctgggactgcaacgggggcggcaaccagcgctggacc
cgggtcggcaaccagctccaggtcctcggcaagtgcctggacgcctacaacaaccagacc
accaacggcaccaaggtggagatctgggactgcaacggccagaccaatcagcagtggacg
gtcaacgccgacggcaccatcaccggcgtgcagtccggcctctgcctggacgtgaccggc
gccgccaccgccaacaacacgctcgtcgaactgtggacctgcaacggcggcagcaatcag
aagtggacgctgagctga

DBGET integrated database retrieval system