KEGG   Actinoplanes sp. SE50/110: ACPL_6037Help
Entry
ACPL_6037         CDS       T02044                                 

Definition
ricin B lectin (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ACPL_6037
  Lipid metabolism
   00561 Glycerolipid metabolism
    ACPL_6037
   00600 Sphingolipid metabolism
    ACPL_6037
Enzymes [BR:ase01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     ACPL_6037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6556178..6557755)
Genome map
AA seq 525 aa AA seqDB search
MRRLLIRSAVLLLGAGLISSVAASPAQALPNNLALTPPMGWNDWNAYGCNVSEALVKQTA
DKIVSAGLATAGYQYVNIDDCWMQKSRDAAGNLQPDLGKFPDGIAGTAAYVHGKGLKLGI
YEDAGTATCAGYPGSLGHEAQDARSFAAWGVDYLKYDNCNNSGSTTTAQYIARYSAMRDA
LAATGRPIVYSICEWGVNAPWTWAGDVGNLWRTTGDIQANYASMLSIFHQNVGLAAYAGP
GRWNDPDMLEVGNGMTATEDRAHFSLWAEMAAPLLAGNNLVTASATTLSILGNRSVIAVD
QDSAGRQGHLVSSTGGLDVLAKPLANGDVSVVLFNENAATATISTTVAAIGKSGASSYGL
ADLWAGTSGSTTGTISAGVPGHGVVMYRVSGGTTGGGTDTVVTIRGAGSGRCLDDPNSST
TNGTQVVIWDCNGGGNQRWTRVGNQLQVLGKCLDAYNNQTTNGTKVEIWDCNGQTNQQWT
VNADGTITGVQSGLCLDVTGAATANNTLVELWTCNGGSNQKWTLS
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccggctgctgatccggtcggcggtgctcctgctcggagcgggtttgatcagtagc
gtcgccgcctccccggcgcaggcgctgcccaacaatctggcgctcaccccgccgatgggc
tggaacgactggaacgcctacggctgcaacgtgtcggaggcgctggtcaaacagaccgcc
gacaagatcgtctcggcgggcctggcgaccgccggctaccagtacgtcaacatcgacgac
tgctggatgcagaagagccgcgacgcggccggcaacctgcagcccgacctcggcaagttt
cccgacggcatcgccggcaccgcggcgtacgtgcacggcaagggtctgaaactcggcatc
tacgaggacgccgggacggccacctgcgccggctacccgggcagcctcggacacgaggcg
caggacgcgcgctcgttcgccgcgtggggcgtcgactacctgaaatacgacaactgcaac
aacagcggctccaccaccaccgcgcagtacatcgcccggtactcggcgatgcgtgacgcg
ctggccgccaccggccggccgatcgtctacagcatctgcgagtggggggtgaacgcgccg
tggacctgggccggtgacgtcggcaacctgtggcgcaccaccggtgacatccaggcgaac
tacgccagcatgctgtcgatcttccaccagaacgtgggtctggccgcctacgccgggccc
ggccggtggaacgacccggacatgctggaggtcggcaacggcatgaccgccaccgaggac
cgcgcgcacttcagcctctgggccgagatggccgcgccgctgttggccggcaacaacctg
gtcaccgccagtgccaccacgctgtccatcctcggcaaccgctcggtgatcgcggtcgac
caggactccgccggtcggcagggtcacctggtcagctccaccggcgggctcgacgtactg
gccaaacccctcgcgaacggcgacgtgtcggtggtgctgttcaacgagaacgcggcgacc
gccacgatcagcaccacggtcgcggcgatcggcaagtccggggcgtccagctacgggctg
gccgacctgtgggccggaaccagcggcagcaccaccgggacgatcagcgccggcgtcccc
gggcacggcgtggtcatgtaccgggtgtccggcggcaccaccggcggcggcaccgacacc
gtcgtcaccatccgcggcgccggctcgggccgctgcctggacgacccgaacagcagcacc
accaacggcacccaggtggtcatctgggactgcaacgggggcggcaaccagcgctggacc
cgggtcggcaaccagctccaggtcctcggcaagtgcctggacgcctacaacaaccagacc
accaacggcaccaaggtggagatctgggactgcaacggccagaccaatcagcagtggacg
gtcaacgccgacggcaccatcaccggcgtgcagtccggcctctgcctggacgtgaccggc
gccgccaccgccaacaacacgctcgtcgaactgtggacctgcaacggcggcagcaatcag
aagtggacgctgagctga

DBGET integrated database retrieval system