KEGG   Actinoplanes sp. SE50/110: ACPL_6130Help
Entry
ACPL_6130         CDS       T02044                                 

Definition
glycoside hydrolase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ase00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6715531..6717120
Genome map
AA seq 529 aa AA seqDB search
MRSMARKAGLAFTAAALALAGAAYGVTSASASAEAAAPLTTPQLVTDMGAGWNLGNQLEA
SNNGIPGETAWGNPVITQALINRVKAAGFRTIRIPVSYLGAIGAAPTYTVDATWLNRIQE
VVDYAYNQGLYVVINMHGDGYKSVTGSWLICDAADQTTVRARYQKVWQQVATRFASYTEH
LILESMNEEFDGQYGNPTQPCYSNINAYNQIFVDTVRRTGGTNASRWLLVPGWNTNIDYT
VGNYGFALPTDQYRSTSIPGTEQRIMISVHYYDPWDFTGQEDGTVTQWGPNATNPAKTST
WGQADYLDGQLKKVHDTFVARGYPVLVGEYGSIDKTAADPTNNRYRADYARALVTAAKKY
GAATAYWDNGYTGAYGFGLFNRSSATVTQQSIIDAIISAAGGTSTSPPPGGSPSATPSAS
PSNTPTGACRVTTAVSAWNTGLTDNITIVNTGGTAVDGWTLTFTLAAGQTITSGWNATYR
PATGTVTATDVGYNGTLAAGASTTIGYQATHTGNAAAPTGFRLNGAACS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgagatcgatggcaagaaaggccgggctcgcgttcaccgccgccgcgctggccctggcc
ggagccgcgtacggcgtgacgtcggcgtcggcgtccgccgaggcggccgccccgctgacc
actcctcagctggtgaccgacatgggcgccggctggaacctcggcaaccagctcgaagcc
agcaacaacggcatccccggcgagacggcgtggggcaacccggtcatcacgcaggccctg
atcaaccgggtgaaggcggccggcttcaggacgatccggattccggtctcctacctgggc
gccatcggcgccgccccgacctacacggttgacgccacctggctgaaccggatccaggag
gtggtcgactacgcgtacaaccagggtttgtacgtggtgatcaacatgcacggtgacggc
tacaaatccgtcacgggctcgtggctgatctgcgacgccgccgaccagacgacggtcagg
gcccggtaccagaaggtgtggcagcaggtcgcgaccaggttcgcgagctacaccgagcac
ctgatcctcgagtcgatgaacgaggagttcgacggccagtacggcaacccgacgcagccg
tgctactccaacatcaacgcgtacaaccagatcttcgtcgacacggtccgcaggaccggt
ggcaccaacgcctcgcgctggctgctcgtccccggctggaacaccaacatcgactacacg
gtcggcaactacggattcgcgctgcccaccgaccagtaccggtcgacgtcgatccccggc
accgagcagcggatcatgatctcggtccactactacgacccgtgggacttcaccggccag
gaggacggcaccgtcacccagtggggcccgaatgccaccaaccccgcgaagacgtccacc
tgggggcaggccgactacctcgacggccagctgaagaaggtgcacgacacgttcgtggcg
cgcggctacccggtcctggtcggtgagtacggctcgatcgacaagaccgcggcggacccc
accaacaaccggtaccgcgccgactacgcgcgcgccctggtcaccgcggccaagaagtac
ggcgcggccaccgcgtactgggacaacggctacaccggggcgtacggcttcgggctgttc
aaccgcagctccgcgacggtcacccagcagagcatcatcgacgccatcatcagcgcggcc
ggcggcaccagcacgagcccgccgcccggcggcagcccgtcggcgaccccgtccgcctcg
ccgtccaacaccccgaccggcgcctgccgggtcaccaccgcggtcagcgcctggaacacc
gggctgaccgacaacatcacgatcgtcaacaccggcggtacggcggtcgacggctggacg
ctgaccttcaccctggccgccggacagacgatcacctccggctggaacgccacctaccgc
cccgccaccggcaccgtcaccgcgaccgacgtcggctacaacggcaccctcgccgccgga
gcctcgaccaccatcggctaccaggccacccacaccggcaacgccgccgccccgaccggc
ttccgcctcaacggcgccgcctgcagctga

DBGET integrated database retrieval system