KEGG   Actinoplanes sp. SE50/110: ACPL_6380Help
Entry
ACPL_6380         CDS       T02044                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ase00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7012643..7013677
Genome map
AA seq 344 aa AA seqDB search
MTRYGPMFGPDYTFLGIPACDWREPSTYADADVVIVGAPFDGGTSHRPGARFGPQVIRGT
DYLAHDGTRPHMAMRVDALGADLTVKDAGDVEVFSGEIERSCRSIEEAVGFIARHGAIPL
VLGGDHTVTWPDVTGVAGAHAASRVSVIHFDAHADTGDIEFGSLYGHGQPMRRLIESGAV
RGDRFLQLGLRGYWPGPDILDWMADQRMNSFHMSEIVERGLDAVLDSAFAIALDGCDGVF
LSVDIDVCDPGHAPGTGTPEPGGLTARQLLDSVSRICHELPVVGMDIVEVSPPFDHAEIT
AMLGNRVVLEALSGMARRRKDGDGPRWKRSTPLLEGRGTTQQPG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgttatggaccgatgttcgggccggactacacgttcctcggcatccccgcctgc
gactggcgggagccgtcgacctacgcggacgccgacgtcgtgatcgtgggcgcgccgttc
gacgggggcacctcgcaccgccccggcgcgcggttcggcccgcaggtcatccgcggcacc
gactacctggcccacgacggcacccgcccgcacatggcgatgcgggtcgacgcgctgggc
gccgacctgaccgtcaaggacgccggcgacgtcgaggtgttcagcggggagatcgagcgc
agctgccgcagcatcgaggaggcggtcgggttcatcgcccggcacggcgcgatcccgctg
gtcctcggcggcgaccacaccgtcacctggccggacgtgaccggggtggccggcgcgcac
gccgcgagcagggtctcggtgatccacttcgacgcgcacgccgacaccggggacatcgag
ttcggctcgctgtacggccacggccagccgatgcgtcggctgatcgagtccggcgcggtc
cgcggcgaccggttcctgcaactgggcctgcgcggctactggccgggtccggacatcctg
gactggatggccgaccagcggatgaactcgttccacatgagcgagatcgtcgaacgcggc
ctggacgcggtgctggacagcgcgttcgccatcgccctggacggctgcgacggcgtcttc
ctctcggtcgacatcgacgtctgcgacccgggccacgcgcccggcaccggcactccggag
cccggcggcctgaccgcccggcagctgctcgacagcgtctcccggatctgccacgagctg
cccgtggtgggcatggacatcgtcgaggtgtccccgccgttcgaccacgcggagatcacc
gcgatgctcggcaaccgggtggtgctggaggcgctgtccgggatggcgcggcgccgcaag
gacggcgacgggccccggtggaagcggtcgacccccctgctagagggccggggcacgacc
cagcagccgggctaa

DBGET integrated database retrieval system