KEGG   Actinoplanes sp. SE50/110: ACPL_6477Help
Entry
ACPL_6477         CDS       T02044                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ase00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ase00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7117479..7118399)
Genome map
AA seq 306 aa AA seqDB search
MIKHLRSAADLDAATATLILDTAAEMAALSGREVKKLPALRGRTVVNLFYEDSTRTRISF
EAAAKRLSADVINFSAKGSSVSKGESLKDTALTLQAMGADAVVIRHAASGAPHRLANWVE
GSVVNAGDGTHEHPTQALLDAYTMRSRLGRLDGLNVAIVGDVLHSRVARSNVLLLTTLGA
RVTLVGPPTLIPVDIAPALSKETRVSYDLDSVLPDSDVVMMLRVQTERMQDSYFPSAREY
SRRYGLDMTRMRKLPEHAIVMHPGPMNRGMEIAPEVADSPRSTIVEQVANGVSVRMAVLY
LLLGGK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaaacatctgcgttcggccgcggacctggacgccgcgaccgccaccctgatcctg
gacaccgccgccgagatggccgcgctctccggccgtgaggtcaagaagctgcccgcgctg
cgcggccgcaccgtggtgaacctcttctacgaggactccacccggacccggatctcgttc
gaggcggccgccaagcgcctctccgccgacgtgatcaacttttcggcgaagggatccagc
gtctccaagggcgagagcctcaaggacaccgcgctgaccctgcaggcgatgggtgccgac
gccgtggtgatccggcacgcggccagcggcgccccgcaccggctggcgaactgggtggag
ggctcggtggtcaacgccggcgacggcacccacgagcacccgacccaggcgctgctcgac
gcgtacacgatgcgctcgcgcctgggccgcctcgacgggctgaacgtggcgatcgtcggc
gacgtgctgcacagccgggtggcccgctccaacgtgctgctgctgaccacgctgggcgca
agagtcaccctggtcggcccgccgaccttgatcccggtcgacatcgcccctgccttgtcc
aaggagacccgagtctcgtacgacctggacagcgtcctgccggacagtgacgtggtgatg
atgctgcgcgtgcagaccgagcggatgcaggactcgtatttcccgtccgcccgggagtac
agccgccgctacggactggacatgacccggatgcgcaaactgccggagcacgcgatcgtg
atgcaccccggcccgatgaaccgcgggatggagatcgcgcccgaggtggccgactcgccc
cgatccaccatcgtcgaacaggtcgccaacggcgtcagcgtccggatggccgtcctctac
ctgctcctgggaggcaagtga

DBGET integrated database retrieval system