KEGG   Actinoplanes sp. SE50/110: ACPL_6534Help
Entry
ACPL_6534         CDS       T02044                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ase00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ACPL_6534 (ruvA)
Enzymes [BR:ase01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ACPL_6534 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7183246..7183848)
Genome map
AA seq 200 aa AA seqDB search
MIASVRGRVAAILHDSTVVEVGGVGMRVFCTPNTLAALRTGAEARLATTLIVREDSLTLY
GFADDDERQLFELLLTANGVGPRIAQAVLAVHQPDAVRRAIGGGDIAALTQVPGIGKRGA
EKMIVELKDKIGPVGFGDAGGTGVLAGAWQEQVRQGVLALGWSATQADQAVAAIGETIDG
EVPPVPILLRQAIRLLGRTR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccagtgtgcgcggccgagtcgccgcgatcctccatgacagcaccgtggtcgag
gtgggcggtgtcggcatgcgggtcttctgcacgccgaacacgctggccgcgctgcgcacc
ggcgcggaggcccggctggccaccacgctgatcgtccgggaggactcgctcaccctgtac
ggcttcgccgacgacgacgagcggcagctgttcgagctgctgctgaccgcgaacggggtg
ggtccgcggatcgcccaggcggtactcgcggtgcatcagccggacgcggtgcgccgggcc
atcggcggcggcgacatcgcggcgctcacccaggtgccggggatcggcaagcgcggcgcc
gagaagatgatcgtcgagctgaaggacaagatcggcccggtcggcttcggcgatgccggc
ggcaccggcgtgctggccggtgcctggcaggagcaggtccggcagggtgtgctcgcactc
ggctggagcgccacccaggccgatcaggcggtcgccgcgatcggcgagacgatcgacggt
gaggtcccgccggtgccgattctgctgcgccaggcgatccggctgctgggtaggacccga
tga

DBGET integrated database retrieval system