KEGG   Actinoplanes sp. SE50/110: ACPL_6609Help
Entry
ACPL_6609         CDS       T02044                                 

Gene name
pcm
Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ase  Actinoplanes sp. SE50/110
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7248633..7249760)
Genome map
AA seq 375 aa AA seqDB search
MTDLRRRYIDLIRQDGVSLSPELATAFGSVPRELFVTGGFHRRDGSWMEPVDPDFLPTVY
SNDVLVTKVDGDRPISSSSQPSLMAIMLAALDVRPGMRILEIGAGTGYNAALLATLGAEV
TSVEVQEDVAAHARAALARAGISRARVVTGDGYPGSPDARYDRVIVTVGVAGLSPHWFAQ
LDPAGFVVAPVEHAGHHPVLTVTGSGTGRVVCSAGFMGAAGPLGARHPGSHPPPAGVLHG
LTETAPPRWDPPLDSTAYRDLWYAAGAWDRRVTRATLPAGEVVRRDARHAFRSGEDIYLT
LLDETGTGGAVLLPDGSVLAGGGDADRRTADAAALIDRWHRRGRPPMRAWQVGLTRAGDP
DAPILVPTTWQPADD
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacggatctgcggcggcgctatatcgatctgatccggcaggacggcgtgtccctgtcg
ccggagttggccacggccttcgggtcggtgccccgggagttgttcgtgaccggtggtttc
caccggcgtgacggcagctggatggagccggtcgacccggatttcctgcccactgtctac
agcaacgacgtcctggtcaccaaggtggacggcgaccggccgatcagctcgtccagccag
ccctccctgatggcgatcatgttggcggccctcgacgtccggccggggatgcggatcctc
gagatcggcgccggcaccggttacaacgcggcgctgctggcgacgctcggggcggaggtg
accagtgtggaggtgcaggaggacgtcgccgcccacgcgcgtgccgcgctggcccgggcg
gggatctcccgggcgcgggtcgtcaccggtgacggttatccgggatctcccgatgcccgg
tacgaccgggtcatcgtcacggtgggtgtcgccggcctctcaccccactggttcgcccag
ctggacccggctggcttcgtcgtcgcgccggtcgagcacgccggccaccatccggtgctg
acggtaaccggatcgggcaccggccgggtggtctgctcggccggtttcatgggcgccgcc
ggcccgctcggcgcccgccacccgggcagccacccgcccccggccggcgtactgcacggc
ctgaccgaaaccgccccgccccgctgggatccgccgttggacagcacggcctatcgggat
ctctggtacgcggccggcgcctgggaccgccgggtcacccgcgccacccttcccgcgggg
gaggtcgtccgccgggatgcccggcatgccttccgcagcggtgaggacatctacctgacc
ctgctcgacgagaccggaaccggtggcgcggtgctcctcccggacggctcggtgctggcc
ggtggcggtgacgcggaccggcgtaccgccgacgccgccgccctgatcgaccgctggcat
cgccggggtcgtccgccgatgcgcgcctggcaggtcggcctgacccgggccggcgacccg
gatgccccgatcctggtccccacgacgtggcagcctgccgacgactaa

DBGET integrated database retrieval system