KEGG   Actinoplanes sp. SE50/110: ACPL_6723Help
Entry
ACPL_6723         CDS       T02044                                 

Gene name
rafA
Definition
glycoside hydrolase clan GH-D (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ase00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ase00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ase00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7388164..7390206)
Genome map
AA seq 680 aa AA seqDB search
MTFTHLRAAGVSFVLNARGAVLYWGADLGELPDGFAASRIPAIPPSSIDVPLQLSLLPSI
EDGWTGRPAFPGHRTRITAVQHGQNTITVRAEQAGKGLELTTECELTPEGVLRLRHRVDN
HGLAVVDLAALNVLLPIPPEATELIDFSGLWAHERRPQRAPLRDGVWSRESRHGRPGHDD
AFLLMAATPGAGFRTGRVWAVHLAWSGDKQIWAERSPLGQSVLGAGELLSPGEIRLAPGD
SYTTPWLIAVYSENGFDGLSDRLHPWIRASRRTAKPRPVVLNTWEAVYFDQSLDRLTALV
DAAAESGVERFVLDDGWFTGRRDDRRALGDWHVDPVIWPDGLHPLIARVEAAGMDFGLWV
EPEMVSPDSVLARAHPEWILGPPDALTWRFQRVLDLAVPAAYAHVLGRLTDLLTEYPIAF
LKWDHNRDLLEPGAAHRQTTALYRLLAELRAAFPELEIESCASGGARIDLGILPHVDRFW
TSDTNDPLDRQLIQRWTSVLIPPEMLGGHLGDGVAHVTGRTSALGLRMATALFGHAGIEW
DLSRAAPADRALIAAWTAEYKRLRGLLHTGVVVRADHPDPAVLLHGVVAPDRSAAVFALV
TLGNPVAALPPPIRFPGLDPDRSYTVRPLGHPPRMVQDAPPPWLAEGAVTLTGRVLAEAG
LPAPLLVPEQAALFTLTAVA
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
gtgaccttcacgcatctgcgggccgcgggcgtcagcttcgtgctgaacgcccgcggtgcg
gtgctgtactggggcgccgatctcggcgaactgccggacggattcgccgccagtcgcatt
ccggcgatcccgcccagctccatcgacgtaccgctgcaattgtcattgctgccgtcgatc
gaggacggctggaccggccgccccgctttccccggccatcggacccggatcactgccgtt
cagcacggtcagaacacgattacggtacgcgcagagcaagccggcaaaggcctggagctg
acgaccgagtgcgagttgactcccgagggcgtgctccgcctgcgccaccgggtcgacaat
cacggcctcgccgttgtcgacctggccgccctgaacgtgctgctgccgattcccccggag
gccaccgagctgatcgatttcagcggcctgtgggcgcacgaacgccgcccgcagcgcgcc
ccgctgcgcgacggcgtctggagccgggagagccgccacggccgccccggccacgacgac
gcgttcctgctgatggcagccactccgggtgccggcttccggaccggccgggtgtgggcg
gtgcacctggcgtggagcggcgacaagcagatctgggcggaacgttcgcccctcggccag
tccgtgctgggcgccggtgaattgctgtcacccggcgagatccggctggccccgggcgat
tcgtacaccaccccgtggctgatcgcggtctattccgagaacggcttcgacggcctttcc
gaccggctgcacccgtggatccgcgcctcccggagaaccgcgaagccccgcccggtcgtg
ctgaacacctgggaggcggtctacttcgaccagtcgctcgaccggctgaccgctctggtc
gacgccgcggcggaatccggcgtcgaacgattcgtgctcgacgacggctggttcaccggc
cgtcgcgacgaccgccgggccctcggcgactggcacgtcgacccggtgatctggccggac
gggctgcacccgctgatcgcccgggtcgaggccgccggaatggatttcggcctctgggtg
gaaccggagatggtcagcccggattcggtactggcccgcgcccacccggaatggattctc
ggcccgccggacgcgctcacctggcgattccagcgggtgctcgatctggccgtcccggcc
gcctacgcccacgtgctgggccgcctgaccgacctgctcaccgagtacccgatcgccttc
ctcaagtgggatcacaaccgtgacctgctcgaacccggtgccgcgcaccggcagaccacc
gcgttgtaccggctgcttgccgagctgcgggcggccttcccggagctggagatcgagagc
tgcgcctccggcggggcccggatcgacctcggcatcctgccgcacgtcgaccggttctgg
acatcggacaccaacgatccgctggaccggcaactgatccagcgctggacgagcgtgctg
atcccgcccgagatgctcggcgggcatctcggtgacggcgtcgcgcacgtcaccggtcgt
acctccgcgctgggcctgcggatggcgaccgccctgttcgggcacgccggcatcgagtgg
gacctctcccgggcggccccggcggaccgggcactgatcgccgcctggaccgccgagtac
aaacggctgcgcggcctgctgcacaccggcgtggtggtccgcgccgaccatcccgacccg
gcggtcctgctgcacggggtggtcgccccggaccgctcggccgcggttttcgccctggtc
acgctgggcaacccggtcgccgcgctgccgccgccgatccggttccccgggctcgacccg
gaccgctcctacacggtgcggccgctgggccacccgccgcggatggtgcaggacgccccg
ccgccgtggctggccgaaggcgccgtcaccctgaccggccgggtgctcgccgaggccggc
ctgcccgccccgctgctggttccggaacaggcggccctgttcacgctgacggccgtcgcc
tga

DBGET integrated database retrieval system