KEGG   Actinoplanes sp. SE50/110: ACPL_7034Help
Entry
ACPL_7034         CDS       T02044                                 

Gene name
choD
Definition
cholesterol oxidase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
ase  Actinoplanes sp. SE50/110
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7769154..7770794
Genome map
AA seq 546 aa AA seqDB search
MTDYDIVIVGSGFGGSVSALRLTEKGYRVGVLEAGRRFTPETLPKTSWDLKNFLWAPKLG
MRGIQRITLLKDIMVLSAAGVGGGSLVYANTLYQPPAPFFADPHWSGITDWAKELEPHYD
QASRMLGVTTQPTMTPSDVVIKQVAEDMGVGHTFRRTPVGVFFGEPGKTVPDPFFGGAGP
DRTGCTECGNCMIGCRVGAKNRLDVNYLYLAESKGATVHPDTEVTKIRPDGAGWVVETAN
GTFTAGQVILAAGALGTQRLLHAMRDTGVLPRISARIGSLTRTNSEALLGAETRKVPAEP
FSRGVAITSSFHPDATTHIEPVRYGPGSNAMGLLSTLLVDGGGRLPRPLRFLVNCIRHPM
VLAHSLSVRRWSERTIIALVMQTLDNSLTVRRTRRGRLTTSPGHGDPNPTWIPVGHEAVR
RIADRIDGFPGGTVGDIFNVPMTAHILGGATIGADADSGVIDPYHRVFHYPGLHVVDGSA
VPANLGVNPSLTITAMAERAMSLWPNKGEADPRPAPGEAYEPVEPVAPHSPAVPAHAPAA
LRRAGK
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgacggattacgacatcgtgatcgtgggcagcggcttcggcggcagcgtcagcgcactg
cgcctgacggagaagggataccgggtcggcgtcctcgaggccggccggcgtttcaccccc
gagaccctgcccaagacgtcatgggacctgaagaacttcctctgggcgccgaagctcggg
atgcgcggcatccagcggatcaccctgctcaaggacatcatggtgctgtccgcggccggg
gtcggcgggggctcgctggtctacgccaacacgctgtaccagccgcccgcgccgttcttc
gccgacccgcactggtccggcatcaccgactgggccaaggagctggagccgcactacgac
caggcgtcccggatgctcggggtgaccacccagccgacgatgaccccgtccgacgtggtg
atcaagcaggtggccgaggacatgggcgtcgggcacacgttccgccgcaccccggtcggg
gtgttcttcggcgagcccggcaagaccgtgcccgacccgttcttcggcggggccggaccg
gaccgcaccggctgcaccgagtgtggcaactgcatgatcggctgccgggtcggcgccaag
aaccggctcgacgtcaactacctctacctggccgagagcaagggcgcgacggtccacccg
gacaccgaggtcaccaagatccggccggacggcgccggctgggtggtggagacggccaac
ggcaccttcaccgccgggcaggtgatcctggccgccggggcgctcggcacgcagcggttg
ctgcacgcgatgcgcgacaccggggtgctgccccggatctccgcccggatcggctcgctg
acccgcaccaactccgaggcgctgctcggcgccgagaccaggaaggtgccggccgagccg
ttcagcaggggcgtcgcgatcacctcgtcgttccacccggacgcgaccacgcacatcgaa
ccggtccggtacgggcccggcagcaacgccatgggcctgctgtccaccctgctggtggac
ggcggcgggcggctgccgcgaccgctgcgcttcctggtcaactgcatccggcacccgatg
gtgctggcccactccctgtcggtgcggcggtggagcgagcgcacgatcatcgcgctcgtg
atgcagaccctggacaattccctgacggtacgtcgcacccggcgcggccggttgacgacg
agcccgggacacggcgacccgaacccgacctggatcccggtggggcacgaggcggtgcgg
cggatcgcggaccggatcgacggcttccccggtggcacggtcggcgacatcttcaacgtt
ccgatgacggcgcacatcctgggcggggcgacgatcggtgcggacgccgacagcggcgtg
atcgacccgtaccaccgggtcttccactaccccgggctgcacgtggtggacggttcggcg
gtgccggccaacctcggggtgaacccgtcgctgacgatcaccgcgatggcggagcgggcg
atgtcgctgtggccgaacaagggcgaggcggatccgcggccggcgccgggcgaagcctac
gagccggtggagccggtggcaccacactcacccgcggtgccggcacatgctccggccgcg
ctgcgccgcgccggaaaatag

DBGET integrated database retrieval system