KEGG   Actinoplanes sp. SE50/110: ACPL_7060Help
Entry
ACPL_7060         CDS       T02044                                 

Gene name
linA
Definition
(GenBank) Lincosamide resistance protein
  KO
K19545  
lincosamide nucleotidyltransferase A/C/D/E
Organism
ase  Actinoplanes sp. SE50/110
Brite
Antimicrobial resistance genes [BR:ase01504]
 Gene variants
  Macrolide resistance genes
   Others
    ACPL_7060 (linA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7799830..7800354
Genome map
AA seq 174 aa AA seqDB search
MAGRHVSTAADVVALFDALDVHRVQACLGGGWAVDALLGEQTREHSDIDLWLPATHLEWA
FRAFAALGVDRLFPTPGDRPWNFVLHDGDRRKIDLHLYETRPDGRLHYGSALTGEPFPAA
ALSGRGEIIGRPVRCEAPVWAVTWHTGYPPRAADRHDVPLLCARFGIPLPETFA
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggccggtcgacacgtctccacggccgcggacgtcgtcgcgctgttcgacgcgctggac
gtgcaccgggtgcaggcctgcctcggcggtgggtgggctgtcgacgccctgctcggcgaa
cagacccgcgagcattccgacatcgacctgtggttgccggccacccacctggagtgggcg
ttccgcgccttcgccgccctgggcgtcgaccgtctgttccccacccccggcgaccgcccc
tggaacttcgttctccacgacggcgaccgccgcaaaatcgacctgcacctgtacgagacc
cgcccggacggccggctgcactacggctccgccctgaccggcgaacccttccccgccgcc
gccctctccggccgcggcgagatcatcggccgcccagtccgctgcgaagcccccgtctgg
gccgtcacctggcacaccggctatccaccccgagccgccgaccgccacgacgtccccctc
ctctgcgcccgcttcggcatccccctccccgagaccttcgcctga

DBGET integrated database retrieval system