KEGG   Actinoplanes sp. SE50/110: ACPL_7062Help
Entry
ACPL_7062         CDS       T02044                                 

Definition
(GenBank) hypothetical protein
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7802130..7802708
Genome map
AA seq 192 aa AA seqDB search
MTIDILQAQSQLIVRQRIRLMVNQYEVHAVTPDGQEAGILAFAQQKRLAFKEQVTLYTDD
TKQVPVLGFKARQVIDLGATYDVFDAAGVVIGLFRKKFGASLLRSTWVLEQPGWPEIVGQ
ERNAFVAILRRFVDSLSWLPYHFDFVVDGRPAFSVERKWGLRDTYRVAIHEPNLDRRLVA
AMAVALDALQSR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatcgatatcctccaggcgcagtcgcagttgatcgtgcgccagcgcattcgtttg
atggtgaaccagtacgaggtccacgcggtgaccccggacgggcaggaagccggcatcctc
gccttcgcgcagcagaagcggctggcgttcaaggagcaggtgaccctgtacaccgatgac
accaagcaggtgccggtgctgggcttcaaggcccgccaggtgatcgacctgggcgccacc
tacgacgtgttcgacgcggccggcgtggtgatcggcctgttccgcaagaagttcggcgcg
tcactgctgcgctcgacctgggtgctggagcagccgggctggccggagatcgtcggccag
gagcggaacgcgttcgtggcgatcctgcgccgtttcgtggactcgctgtcctggctgccg
taccacttcgacttcgtggtcgacggccggccggcgttctcggtggagcgcaagtggggc
ctgcgggacacctaccgggtcgcgatccacgagccgaacctggaccgtcgcctggtggcc
gcgatggccgtcgcgttggacgcgctgcagtcccggtaa

DBGET integrated database retrieval system