KEGG   Actinoplanes sp. SE50/110: ACPL_7063Help
Entry
ACPL_7063         CDS       T02044                                 

Gene name
dgt
Definition
(GenBank) dGTPase
  KO
K01129  
dGTPase [EC:3.1.5.1]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ACPL_7063 (dgt)
Enzymes [BR:ase01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.5  Triphosphoric-monoester hydrolases
    3.1.5.1  dGTPase
     ACPL_7063 (dgt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7802719..7804185
Genome map
AA seq 488 aa AA seqDB search
MDDPRAQRLFGDSTVAPGDLAFSPFRVDRDRIVSSPFFARLAGVTQVISPGGAGLLVHNR
LTHSLKVAQVARAIAERIGAAEPDLAEKLGGCDPDVVEAAALAHDLGHPPFGHLGERVLD
RLARQRLGLPDGFEGNAQSYRIVTSTEIRGQATIGLNLTNATRAAILKYPWTRHDYPEPH
PRFMDPPPRGAAAHPEEPAGGSTKFSAYSTEVGDVRAARAPFAGRVADWQQTVEASVMDT
ADDIAYAIHDLEDVHRVGVLQQGAVATELMAWQRWGAETDLRRAGGAIESLRRSLHRKEG
WIADDDAFAGAVELVRAELVDGLLAQPFDGSVQAEARVAAFSATWTRRLVDSVELTEQAA
VRSGHVQLSVAQWHEVQVLKFVQNRFVLARPDLALHQRGQGRLLSSLVEALLAWLTDPDE
ADRLPRRLRDLVELAESELPADTPQRIGRARGRAVVDFVAGLTDGQAVGLMEALSGRSRQ
LWTDAFVL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggacgatccgcgcgcccagcgacttttcggcgacagcacggttgcccccggcgatctg
gctttcagcccgttccgtgtcgaccgggaccggatcgtcagctccccgttcttcgcccgc
ctcgccggggtcacccaggtgatcagccccggcggggccgggctgctggtgcacaaccgg
ctcacccacagtttgaaggtcgcgcaggtggcccgggcgatcgccgagcggatcggggcc
gccgagccggatctggcggagaagctgggcggctgtgacccggatgtggtggaggccgcc
gcgctcgcccacgatctggggcacccgccgttcgggcatctgggtgagcgggtgctggac
aggctggcccggcagcggctgggcctgccggacggtttcgagggcaatgcccagtcgtat
cggatcgtgaccagcaccgagatccgcgggcaggccacgatcgggttgaacctgacgaac
gccacccgggcggcgatcctgaagtatccgtggacccggcacgactatccggagccgcac
ccccggttcatggatccgccgccgcgcggggcggccgcccacccggaggagccggcgggt
ggttcgacgaagttcagcgcctattcgaccgaggtcggcgatgtgcgggcggcccgggcg
ccgttcgccgggcgggtggcggactggcagcagacggtcgaggcgtcggtgatggacacg
gccgacgacatcgcgtacgccatccatgacctggaagatgtgcatcgggtcggcgtgttg
cagcagggtgcggtcgccaccgagttgatggcgtggcagcggtggggcgccgagacggac
ctgcgccgggccggcggggcgatcgagtcgctgcgccgcagcctgcaccgcaaggagggc
tggatcgccgacgacgacgcgttcgccggcgcggtggagttggtccgggccgagctggtg
gacgggctgctggcccagccgttcgacgggtcggtgcaggccgaggcgcgggtggcggcg
ttctcggcgacctggacccggcggctggtcgactcggtggagttgaccgagcaggccgcg
gtgcgcagcgggcacgtgcagctgtccgtggcgcagtggcacgaggtgcaggtgctcaag
ttcgtgcagaacaggttcgtgctggcccgtcccgacctggcgctgcaccagcgcgggcag
ggtcggctgctgtcctcgctggtggaggcgttgctggcctggctgaccgatccggacgag
gcggaccggctgccgcggcggctgcgggatctggtcgagctggccgagtcggagctgccg
gcggacaccccgcagcggatcggtcgggcccgcgggcgcgcggtggtcgacttcgtggcc
gggctgaccgacgggcaggcggtggggctgatggaggcgctgtccggtcgctcgcggcag
ctctggacggacgccttcgtcctgtga

DBGET integrated database retrieval system