KEGG   Actinoplanes sp. SE50/110: ACPL_7066Help
Entry
ACPL_7066         CDS       T02044                                 

Definition
(GenBank) hypothetical protein
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7806071..7806952)
Genome map
AA seq 293 aa AA seqDB search
MEDSRFTRANLLFVGLIAVLGVGAFFTAVQSGRQDSALLFVAFPTVLAVLVALYPTGTTH
GTVFRFTTVALLVCAVQLHEGAICVVLAAPLVYLVAHGVTGLVRMSKRRGNHLYALLPLP
LLLVGSAEGTSGDLRIHPDQSVEVTRVVALAPDQVRAVLEAGPQPTATRSLPLRLLDVPV
PEHVHGDGLAPGDRWTFVYHGSSHGPGGDIVTRVTDAGPARVTWSVIEDTSITGRWVGMR
DATLTWHTVPAGTSITLRVDYRRGLDPSWYFGPLQDGLMHAGAEHLLDMLSLR
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggaagactcacgcttcaccagggcgaacctcctgttcgtcggcctgatcgcggtgttg
ggggtgggggccttcttcaccgccgtgcaatccgggcggcaggacagcgcgttgctcttc
gtggcttttccgaccgtgctggctgtgctggtggcgctgtatccgaccggcaccacccac
ggcacggtcttccgcttcaccacggtcgccctgctggtctgcgccgtgcagctgcatgag
ggggcgatctgcgtggtgctcgccgcaccgctggtctacctggtcgcgcacggcgtcacc
gggctggtccggatgtcgaaacggcgcggcaaccacctgtatgcgctgctgccgctgccc
ctcctgctggtcggcagtgcggaggggaccagcggcgacctccggatccacccggaccag
tcggtcgaggtcacccgcgtggtcgccctcgcacccgaccaggtccgcgccgtcctggag
gccggcccgcagccgacagccacccgctcgctgccgctgcgcctgctcgacgtcccggtg
cccgagcacgtgcacggcgacggcctggcccccggcgaccgctggaccttcgtctaccac
ggcagctcgcacggccccggcggcgacatcgtcacccgggtcaccgatgccgggccggcc
cgggtcacctggagcgtcatcgaggacacctcgatcaccggccgctgggtcgggatgcgc
gacgccaccctgacctggcacaccgtcccggccggcacctcgatcacgctgcgcgtcgac
taccgccgcggcctcgacccgagctggtatttcggcccgctgcaggacggcctgatgcac
gccggcgccgagcacctcctcgacatgctgtcgctgcgatga

DBGET integrated database retrieval system