KEGG   Actinoplanes sp. SE50/110: ACPL_7068Help
Entry
ACPL_7068         CDS       T02044                                 

Definition
(GenBank) hypothetical protein
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HipA_C
Motif
Other DBs
NCBI-ProteinID: AEV87948
UniProt: G8SFF7
Position
7807648..7808370
Genome map
AA seq 240 aa AA seqDB search
MLREVTAIRYVTPLREGGSLPGVVEADDLGTYVVKFRGAGQGPKALVAEVIAGELARRLG
LPVPELARVELDPVVARAEPDEEVQELIKASAGGNLGMDFLPGALGYDPNAHPVEAGLAS
RVLAFDAYVENVDRSWRNPNLLIWHGGLWLIDHGATLYFHHDWARAEAVVHRPYRWEDHV
LKPYATALATEGPALAARLTRDLLAEVVALVPQDWLDDGDREAYLDHLARRAERPEAWLP
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgctacgtgaggtcaccgcgatcaggtatgtgacgcccctgagagagggcggttcgctg
cccggcgtcgtcgaggccgacgacctcgggacgtacgtggtgaagttccgcggcgccggg
cagggaccgaaagcgctggtggccgaggtgatcgccggtgagctggcgcgccgcctcggc
ctgccggtgccggagctggcccgcgtcgagctggacccggtggtcgcccgggccgagccg
gacgaggaggtccaggagctgatcaaggcgagcgccggcggcaacctggggatggacttc
ctgcccggcgcgctcggctacgacccgaacgcgcacccggtcgaggccgggctggccagc
cgggtgctggccttcgacgcgtacgtggagaacgtcgaccgcagctggcgcaacccgaac
ctgctgatctggcacggcggcctgtggctgatcgaccacggcgccaccctgtacttccac
cacgactgggcgcgggccgaggcggtggtgcaccgcccctaccggtgggaggaccacgtg
ctcaagccgtacgccaccgcgctggccaccgagggcccggcgctggccgcccggctcacc
cgcgacctgctggccgaggtggtcgccctggtcccgcaggactggctggacgacggcgac
cgcgaagcctacctcgaccacctcgcgcgccgcgccgagcgtccggaggcctggctgcca
tga

DBGET integrated database retrieval system