KEGG   Actinoplanes sp. SE50/110: ACPL_7080Help
Entry
ACPL_7080         CDS       T02044                                 

Gene name
thyA
Definition
(GenBank) thymidylate synthase
  KO
K00560  thymidylate synthase [EC:2.1.1.45]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00240  Pyrimidine metabolism
ase00670  One carbon pool by folate
ase01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ACPL_7080 (thyA)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ACPL_7080 (thyA)
Enzymes [BR:ase01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     ACPL_7080 (thyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylat_synt
Motif
Other DBs
NCBI-ProteinID: AEV87960
UniProt: G8SFG9
Position
complement(7819126..7819923)
Genome map
AA seq 265 aa AA seqDB search
MAVDTQYEDLLRRVLETGTRKSDRTGTGTRSLFGERLRYDLSQGFPLVTTKRVHFKSIAV
ELLWFLRGETNVQWLRDQGVTIWDEWASESGELGPVYGYQWRSWPTPDGHVDQISEILDT
LRTDPDSRRMIVSAWNVGQLDEMALMPCHAMFQFYVADGRLSCQLYQRSADLFLGVPFNI
ASYALLTRMVADQVGLTPGDFIWVGGDCHIYDNHVEQVREQLGRQAYPFPALEIAKRPSL
FDYEYADFTVVGYEHHPAIKAPVAV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccgtggacacgcagtacgaagatcttctccggcgggtgctggagaccggcacccgc
aagagcgaccggaccgggaccggcacccgcagccttttcggcgagcggctgcgctacgac
ctgtcccaggggtttccgctggtcacgaccaagcgggtgcacttcaagtcgatcgcggtg
gagctgctgtggttcctgcgcggcgagacgaacgtgcagtggctgcgcgatcagggcgtg
acgatctgggacgagtgggcctcggagtcgggcgagctcgggccggtctacggctaccag
tggcggtcgtggcccacgccggacggccacgtggaccagatctccgagatcctggacacg
ttgcgtaccgatccggactcgcgccgcatgatcgtctcggcctggaacgtggggcagctc
gacgagatggcgctgatgccgtgccacgcgatgttccagttctacgtggccgacggccgg
ctgtcctgccagctctaccagcgcagcgccgacctgttcctcggcgtgccgttcaacatc
gcgtcgtacgcgctgctcacccggatggtcgccgaccaggtcgggctgaccccgggcgac
ttcatctgggtgggcggcgactgccacatctacgacaaccacgtcgagcaggtgcgcgag
cagctcggccggcaggcgtacccgttcccggcactggagatcgcgaagcggcccagcctc
ttcgactacgagtacgccgacttcaccgtcgtcggctacgagcaccacccggcgatcaag
gcgccggtcgcggtatga

DBGET integrated database retrieval system