KEGG   Actinoplanes sp. SE50/110: ACPL_7082Help
Entry
ACPL_7082         CDS       T02044                                 

Definition
(GenBank) isoamylase N-terminal domain-containing protein
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMPK1_CBM CBM_48
Motif
Other DBs
NCBI-ProteinID: AEV87962
UniProt: G8SFH1
Position
complement(7820610..7820864)
Genome map
AA seq 84 aa AA seqDB search
MIKRSKLFGNKTRVTFSLPADEPSGVVSVVGTFNDWQPGRHELQVRRNGTRTVSVPLDPG
EYEFRYLATGGVWFDDPEGSELRL
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagcgcagcaagttgttcggcaacaagacccgggtgaccttcagcctcccggcg
gacgagccgtccggggtggtcagtgtggtgggcacgttcaacgactggcagccgggccgg
cacgagctgcaggtgcgccgcaacgggacccgcacggtcagcgtgccgctggacccgggg
gagtacgaattccgctacctggcgaccggcggcgtgtggttcgacgacccggagggcagc
gaactccgcctataa

DBGET integrated database retrieval system