KEGG   Actinoplanes sp. SE50/110: ACPL_7085Help
Entry
ACPL_7085         CDS       T02044                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACPL_7085 (hemG)
Enzymes [BR:ase01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     ACPL_7085 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7822087..7823481)
Genome map
AA seq 464 aa AA seqDB search
MRKRIAVVGGGIAGLAAAVRLRDVTRADTEIIVYEQSGALGGKLRTGELAGLRVERGAES
FLNGSPDGGPSAAVRFAHRVGLGDALVHPAAQPAALAIGGALARIPAGTLVGVPGDLSAL
DGVALPEADADADTGHPLLAAGQDIAVGELVRSRYGAEVVDRLVDPMLGGVYAGRADRLS
LRATMPQLARTAETEHTLRGAVRAAQALSRRTPGQPVFAAVDGGMSRLIGAAATTARARI
SLGLPVRGITRTGNRWHLTLGPAPQPQTDEVDAVILAVPAAPAARLLADLAPGAAAALGD
LEYASVALAGMALPPGTRLPELSGFLVPPGEGTLVKAATFFTRKWPHLTGPDGPVIVRAS
LGRAGEQERLQLSDPALLAIAHRELSELAGTRLPSPTASWIQRWGGGLPQYAPGHPDRVA
AARAALPAGIALAGAALDGVGIPVCVASGEQAADDVNSYLEASA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgcggaagcggatcgcggttgtcggcggcgggatcgccgggctggcggccgctgtccgc
ctgcgggacgtgacgcgggcggacaccgagatcatcgtgtacgagcagagcggcgccctg
ggcggcaaactgcgcaccggtgagctggccgggctgcgcgtcgagcggggcgccgagtcg
ttcctgaacggttcgccggacggtggcccgtccgcggcggtccggttcgcccaccgggtc
ggcctcggtgacgccctggtgcacccggcggcccagccggcagccctggcgatcggcggg
gcgctggcccggattccggccggcaccctggtcggcgtgcccggcgacctgtccgcgctg
gacggtgtcgccctgccggaggcggacgcggacgccgacaccggccacccgctgctcgcc
gccggtcaggacatcgcggtcggcgagctggtccgctcgcggtacggcgccgaggtggtg
gaccggctggtcgacccgatgctgggcggggtctacgccggccgggcggatcggctgtcg
ctgcgggccaccatgccgcagctggcccgcaccgcggagaccgagcacaccctgcgcggc
gcggtccgggccgcgcaggcgctgagccggcgcaccccggggcagccggtgttcgcggcc
gtggacggcgggatgagccggttgatcggggcggcggcgaccacggcacgcgcccggatc
agtctgggactgccggtgcgcgggatcacccgtaccggcaatcgatggcatctgaccctg
gggccggcaccgcagccccagaccgacgaggtcgacgccgtgatcctggccgtgccggcg
gcgccggcggcccggttgctcgcggatctcgcgcccggggccgcggccgcgctcggcgac
ctggagtacgcgagcgtcgcgctggccgggatggcgctgccgcccggcacgcggctgccc
gagctgtccggcttcctggtgccgccgggggaggggacgctggtcaaggccgcgacgttc
ttcacccggaaatggccgcacctgaccgggccggacggtccggtgatcgtccgggcgtcg
ctgggccgggccggggagcaggagcggctgcagctgagcgacccggcgctgctggcgatc
gcgcaccgggagctgagcgagctggccgggacgcggctgccgtcgccgaccgcgtcctgg
atccagcggtggggcggtggcctgccgcagtacgcgccgggtcatccggatcgcgtggcg
gccgcgcgggccgcgctgcctgcggggatcgcgctcgccggggcggctctcgacggtgtc
ggcatccccgtctgtgtggccagcggggagcaggcggcggacgatgtgaacagttacctg
gaggcaagtgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system