KEGG   Actinoplanes sp. SE50/110: ACPL_7089Help
Entry
ACPL_7089         CDS       T02044                                 

Definition
(GenBank) ribonuclease D
  KO
K03684  ribonuclease D [EC:3.1.13.5]
Organism
ase  Actinoplanes sp. SE50/110
Brite
Enzymes [BR:ase01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.5  ribonuclease D
     ACPL_7089
Transfer RNA biogenesis [BR:ase03016]
 Prokaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    ACPL_7089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_A_exo1 HRDC
Motif
Other DBs
NCBI-ProteinID: AEV87969
UniProt: G8SGS9
Position
7826468..7827703
Genome map
AA seq 411 aa AA seqDB search
MPPDPSSGGSEAVPLTAPRDGTPAPVESADGLAEVVARMAAGSGPVAVDAERASGYRYTQ
RAYLVQLRRAGSGTVLIDPLPLDDLRTLDTALADTEWVLHAASQDLPCLAELGMKPRRLF
DTELAARLAGFERVGLAALTEHLLGYSLEKHHSAADWSTRPLPESWLTYAALDVELLTDL
RDLLATELDKQGKAGWAAEEFASLVASADRPPRVRPDPWRRTSGIHRVRGARAQSRVRAL
WYARDAIAARKDSAPGRVLPDSAIVAAAEADPKDERTLLAIPGFGGRSVRRLVKTWLDAL
DQARALPDDALPVNQPVEGPPPPHRWAERDPIAAARLARCRQVVVGTAETYRLPPENLIS
PDFIRRLAWSPPDEVSAQTVSDTLRGFGARNWQVGLIAGQLAGVLPAPFTD
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcccgacccgagttctggcggttccgaggctgttcccctgacggcgccccgcgat
ggcacccccgccccggtggagagcgccgacggcctggccgaggtggtggcccggatggcc
gccggctccggccccgtcgccgtggacgccgaacgcgcctccggctaccgctacacccag
cgggcctacctggtgcagctgcgccgggccgggtccggcaccgtgctgatcgacccgctg
ccgctggacgacctgcgcaccctggacaccgccctggccgacaccgagtgggtgctgcac
gccgccagccaggacctgccgtgcctcgccgagctggggatgaagccgcgccggctgttc
gacaccgagctggccgcccggctggccgggttcgagcgggtcggcctggccgcgctcacc
gagcacctgctcggctactcgctggagaaacaccactcggcggcggactggtcgacccgg
ccgctgccggagtcctggctgacctacgcggcgctggacgtggaactgctcaccgacctg
cgcgacctgctcgccaccgaactggacaagcagggcaaggccggctgggcagccgaggag
ttcgcctcgctggtggccagcgccgaccggccgccccgggtccggcccgacccgtggcgc
cgcacctccggcatccatcgggtgcgaggtgcgcgggcgcagtcccgggtccgcgcgctg
tggtacgcgcgggatgcgatcgccgcccggaaggactcggcgcccggccgggtgctgccc
gactcggcgatcgtcgccgcggccgaggccgatccgaaggatgagcggaccctgctggcc
atcccgggcttcggcgggcgttcggtccgccggctggtcaagacctggctggacgcgctg
gaccaggcgcgggcactgccggacgacgcgctgccggtgaaccagccggtggaggggccg
cccccgccgcaccggtgggccgaacgggatccgatcgccgcggcccggctggcccgctgc
cgccaggtggtggtcggcaccgcggagacctaccggctgcccccggagaacctgatcagt
ccggacttcatccgccggctggcctggtcgccgccggacgaggtctcggcgcagacggtg
agcgacacgctgcgcggcttcggtgcccgcaactggcaggtcggcctcatcgccggccag
ctcgccggcgtcctgcccgcccccttcaccgactga

DBGET integrated database retrieval system