KEGG   Actinoplanes sp. SE50/110: ACPL_7090Help
Entry
ACPL_7090         CDS       T02044                                 

Definition
(GenBank) acetyl-CoA acyltransferase
  KO
K00632  
acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Benzoate degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    ACPL_7090
   00592 alpha-Linolenic acid metabolism
    ACPL_7090
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACPL_7090
  Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    ACPL_7090
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACPL_7090
   00642 Ethylbenzene degradation
    ACPL_7090
Enzymes [BR:ase01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     ACPL_7090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7828090..7829286
Genome map
AA seq 398 aa AA seqDB search
MPREVREVVFVDGVRTPFGKAGGMYAETRADDLVIRCIRELIKRNPQLPTDRVDEVAIAA
TTQTGDQGLTIGRTAALLAGLPKTVPGYAVDRMCAGAMTAVTNVAGGIAMGAYDIAVAGG
VEHMGRHPMGEGADPNPRILTEKLVDPSALVMGATAENLHDRLPHITKERTDLFALNSQL
KVAKAYANGKLQPDLVPVAIRSSELGWGLATVDEAPRETSLEKLATLKTPFRPHGRITAG
NAAGLNDGATAALLADEATARELGLPVAMRLVSYAYVGVEPEIMGYGPIPSTEKALKKAG
LTIDDIGLFELNEAFAVQVLALLDHYGIADDDPRVNPWGGAIAVGHPLASSGVRLMTQLA
RHFEEHPEVRYGMNAMCIGIGMGGTVIWENPNWEGFKK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgtgaagtacgcgaggtcgtcttcgtcgacggcgtccgcaccccgttcggcaag
gcgggcggcatgtacgccgagacccgcgccgacgacctggtgatccgctgcatccgagag
ctgatcaagcggaatccccagctccccacggaccgggtggacgaggtcgcgatcgcggcc
accacccagaccggcgaccagggcctgaccatcggccggaccgccgccctgctggccgga
ctgcccaagacggttcccggctacgccgtcgaccggatgtgcgccggcgcgatgaccgcg
gtgaccaacgtcgccggcggcatcgcgatgggggcgtacgacatcgccgtcgccggtggt
gtcgagcacatgggccggcacccgatgggtgagggcgccgacccgaacccgcggatcctg
accgagaagctggtcgacccgtccgccctggtgatgggcgcgaccgcggagaacctgcac
gaccggctgccgcacatcaccaaggagcgcaccgacctcttcgcgctcaactcgcagctc
aaggtcgccaaggcgtacgccaacggcaagctgcagccggacctggtgccggtcgcgatc
cgctcgtccgaactgggctggggcctggccaccgtcgacgaggcgccgcgcgagacctcg
ctggagaaactcgccacgctgaagacgccgttccgcccgcacggccggatcaccgcgggc
aacgcggccggtctcaacgacggcgccaccgcggcgctgctggccgacgaggccaccgcc
cgcgagctcggcctgccggtcgcgatgcggctggtgtcgtacgcctacgtgggtgtcgag
ccggagatcatgggttacggcccgatcccgtcgaccgagaaggcgctgaagaaggccggc
ctcaccatcgacgacatcggcctgttcgagctgaacgaggccttcgccgtgcaggtgctg
gccctgctggaccactacggcatcgccgacgacgacccgcgggtcaacccgtggggcggc
gcgatcgccgtgggccacccgctcgcctcctccggcgtgcgcctgatgacccagctcgcc
cggcacttcgaggagcaccccgaggtccggtacggcatgaacgcgatgtgcatcggtatc
ggcatgggtggcaccgtgatctgggagaacccgaactgggaaggcttcaagaagtga

DBGET integrated database retrieval system