KEGG   Actinoplanes sp. SE50/110: ACPL_7091Help
Entry
ACPL_7091         CDS       T02044                                 

Gene name
fadB
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7829283..7831346
Genome map
AA seq 687 aa AA seqDB search
MIENPNEVVTKALLRSVRVPGLDKPAALITLDNGFDHKKPNSFGPAGLQSLDEAITGALA
ADPAFIAVTGKPYIFCVGADITGMPLLSSREQAVELGELGHRVFARLRNSTIPTFAFVNG
AALGGGLEVALHCHYRTVSSGATALGLPEVAIGLIPGWGGSQLLPNLIGIAGAAQVILQN
PLTQKVLRPKQARELGVADALFEAADFLEDSLAWAAGVVKGEVTVERPEIDRDMWDGVLW
FAKNQLDEKLHGAVPSANKALELLALAKEATFEDGTAAETEALADLIMGDEARASLYAFD
LVQRRAKRPVGVPDKSLARKVTKVGIVGAGLMASQLALLFLRRLQVPVVLTDLDQERVDK
GVAYVTGEIDKLVGKRRLDEGTAAKLRGLISGSVDKSVFADADFVIEAVFENLDLKKKIW
AEFETIVKPEAILATNTSSLSITEMAAGLQHPERVVGFHFFNPVAVLPLLEIIRGEQTDD
ATLATAFAVGRELKKSSVLVKDAPAFVVNRVLTRFTSEVFKAVDAGTPLEVVNEAFDPMG
LPMRPIALLQLVGPAVAYHVGETLHRAFPERYVDSPNLKRIVDAGLPLLVDDEINADVVK
LLEVGDTVLTGDEVRAKALAALAEEIRIMLDEGVVAEAQDIDLCMILGAGYPFHLGGITP
YLDRSGIAEQITGQRFLPNGLADVRRS
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgagaacccgaacgaggtagtgaccaaggcgctgctgcgttccgtccgggtaccc
gggctggacaagccggccgcgctgatcaccctggacaacggcttcgaccacaagaagccg
aacagcttcggcccggccgggctccagtcgctggacgaggcgatcaccggggctctcgcg
gcggacccggcgttcatcgcggtcaccggcaagccctacatcttctgcgtcggcgcggac
atcaccggcatgccgctgctctcctcccgggagcaggccgtcgagctgggcgagctgggg
caccgggtgttcgcccggctccggaacagcaccatcccgaccttcgcgttcgtcaacggc
gcggcgctcggcggcggcctcgaggtggcgctgcactgccactaccgcaccgtctcctcc
ggcgcgaccgcgctcggcctgcccgaggtcgcgatcggcctgatccccggctggggcggc
tcgcagctgctcccgaacctgatcggcatcgccggcgcggcgcaggtcatcctgcagaac
ccgctgacccagaaggtgctgcgcccgaagcaggccagggagctgggcgtcgccgacgcg
ctgttcgaggccgccgacttcctcgaggactcgctggcctgggcggccggcgtggtcaag
ggcgaggtcacggtcgagcgcccggagatcgaccgggacatgtgggacggcgtgctgtgg
ttcgccaagaaccagctcgacgagaagctgcacggcgcggtcccgtccgccaacaaggct
ctggagctgctggctctggccaaggaggcgacgttcgaggacggcaccgcggccgagacc
gaggcgctcgccgacctgatcatgggtgacgaggcccgcgccagcctgtacgcgttcgac
ctggtccagcggcgcgccaagcgcccggtcggggtgccggacaagtccctggcgcgcaag
gtcaccaaggtcggcatcgtcggcgccggtctgatggcctcccagctcgccctgctgttc
ctgcgccgcctgcaggtcccggtcgtgctcaccgacctggaccaggagcgggtcgacaag
ggcgtggcgtacgtcaccggcgagatcgacaagctggtcggcaagcgccgcctggacgag
ggcaccgcggccaagctgcgcggcctgatcagcggctcggtcgacaagtcggtgttcgcc
gacgccgacttcgtgatcgaggcggtcttcgagaacctcgacctgaagaagaagatctgg
gccgagttcgagaccatcgtcaagccggaggcgatcctcgccaccaacaccagctcgctg
tcgatcaccgagatggcggccggcctgcagcacccggagcgggtcgtcggcttccacttc
ttcaacccggtcgcggtcctgccgctcctggagatcatccgcggcgagcagaccgacgac
gcgacgctggccaccgcgttcgccgtgggccgcgagctgaagaagtcctcggtgctggtc
aaggacgccccggcgttcgtggtcaaccgggtgctcacccggttcaccagcgaggtcttc
aaggcggtcgacgccggcaccccgctcgaggtggtgaacgaggcgttcgacccgatgggc
ctgccgatgcgcccgatcgcgctgctccagctggtcggcccggccgtggcgtaccacgtc
ggcgagaccctgcaccgcgccttcccggagcggtacgtggacagccccaacctgaagcgg
atcgtcgacgccggcctgccgctgctggtcgacgacgagatcaacgccgacgtggtgaag
ctgctcgaggtcggcgacaccgtgctcaccggcgacgaggtgcgggccaaggccctcgcc
gcgctggccgaggagatccggatcatgctggacgagggtgtcgtcgccgaggcgcaggac
atcgacctgtgcatgatcctgggcgccggttacccgttccacctcggcggaatcacgccg
tacctggaccggagcggtatcgcggagcagatcaccggtcagcgtttcctgccgaacggg
ctggcggacgttcgccggtcctga

DBGET integrated database retrieval system