KEGG   Actinoplanes sp. SE50/110: ACPL_7093Help
Entry
ACPL_7093         CDS       T02044                                 

Gene name
cutS
Definition
(GenBank) histidine kinase
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP SCAB_CC HATPase_c_5 PNTB_4TM
Motif
Other DBs
NCBI-ProteinID: AEV87973
UniProt: G8SGT3
Position
complement(7832351..7833583)
Genome map
AA seq 410 aa AA seqDB search
MTVYQGQPVQHRESFLRRLARPTLRLRLTLLNGILLVAAGAVLVVLAWLLVDEPLHPADR
LRVGSSVTLNDGTTREARSWQTETIDEASDQLLVKGLSALVAISIIGIAGGYLVTRRALR
PLHQVTQTAQRLGEETLDQRIRYAGADDEVAELARTFDAMLDRLAGAFESQKRFVANASH
ELRTPLAVMRTEIDVTLSDPDADLAEYRRMARVVRDASSRANGLVDALLVLARSEAQSGR
RLVRKVPADLATSVYNALSAVKEEAERMRLEVTTDLAAAPVVGDPSLLDRLAGNLIENAI
RYNHLLGRLWLRTVSVDGQARLIVGNTGHEVEQAEVPGLFEPFRRGGWERTGSRGSGLGL
SIVRAVCDAHGGTVSAIALADGGLEVTVSLPAADTTPVVAATASVPRGRS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtctatcaggggcagccggtccagcaccgggagagcttcctgcgccggctggcc
cggcccaccctgcggctgcggctcaccctgctgaacgggatcctgctggtggccgccggc
gcggtgctggtggtgctggcctggttgctggtcgacgagccgctgcacccggccgacagg
ctgcgggtcgggtcgagtgtgacgctgaacgacggcaccacccgggaggcccggtcctgg
cagaccgagaccatcgacgaggcctccgaccagttgctggtcaaggggctgagcgcgctg
gtggcgatcagcatcatcgggatcgccggcggctatctggtgacccgccgggcgctgcgg
ccactgcaccaggtcacccagaccgcgcagcggctcggtgaggagacgctggaccagcgg
atccggtatgccggggcggacgacgaggtggccgagctggcccgcaccttcgacgcgatg
ctggaccgcctggccggcgcgttcgagtcgcagaagaggttcgtcgctaacgcctcgcac
gagttgcgcaccccgctcgcggtgatgcgcaccgagatcgacgtgacgctcagcgacccg
gacgccgacctggccgagtaccgccggatggcccgggtcgtccgggacgcctccagccgg
gcgaacgggctggtcgacgcgctgctggtgctggcccgttcggaggcgcagtccggccgg
cgactggtccgcaaggtgccggccgacctggccaccagcgtgtacaacgcgttgtcggcg
gtgaaggaggaggccgagcggatgcggctggaggtcaccacggacctggccgcggccccg
gtggtgggcgacccgagtctgctggaccggctggccggcaacctgatcgagaacgccatc
cggtacaaccacctgctcggccggctgtggctgcgcaccgtctcggtggacgggcaggcg
cggctgatcgtcggcaacaccgggcacgaggtggagcaggccgaggtgcccgggctgttc
gagcccttccgccggggcggctgggagcggaccgggtcgcggggctccggcctgggcctg
tcgatcgtgcgggccgtctgcgacgcgcacggcggcacggtgtcggcgatcgcgctggcc
gacggtggcctggaggtcaccgtctcgctgccggccgccgacaccactccggtggtggcg
gcgaccgccagcgtgccgaggggccggagctag

DBGET integrated database retrieval system