KEGG   Actinoplanes sp. SE50/110: ACPL_7099Help
Entry
ACPL_7099         CDS       T02044                                 

Gene name
dctA
Definition
(GenBank) C4-dicarboxylate transport protein
  KO
K11103  
aerobic C4-dicarboxylate transport protein
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:ase00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ACPL_7099 (dctA)
Transporters [BR:ase02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ACPL_7099 (dctA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7842301..7843704
Genome map
AA seq 467 aa AA seqDB search
MSVDAPAPRRRDRSHLLYLCVLLAMALGIAVGFAFPDFAVKLKPLGTGFVGLIRMMIAPV
IFCTLVLGVGSIRRAAQVGRVGGLALGYFLIMSTVALTIGLIVGNILHPGAGLHLSQELA
KTGTAQVSRTAEGGVDFVLGIIPDTLISALTSTQVLQTLLVALLVGFAVQSLGARGEPVI
AAVALAQRVVFRILAMIMWLAPIGAFGAMAALVGATGFAALKSLAAIMVGFYVTCAIFVF
LVLGLLLRLVAGVSIGRLLRYLAREFLLILSTSSSESALPRLIAKMGHLGVSRPVVGIVV
PTGYSFNLDGTAIYLTMASLFIADALDRPLSIGQQIGLLLFMIVASKGAAGVTGAGLATL
AGGLQSHRPDLVPGVGLIVGIDRLMSEARALTNFAGNAVATILIGTWTHEIDRDQAARVL
SGEAPFDESTFDDDPHAGGTPPPAVDAASPASASAPPSPLAGPPTAL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcgatgcccccgctccgcggcgccgggaccgcagccacctcctctatctctgc
gtgctcctcgcgatggccctgggcatcgcggtgggcttcgccttccccgacttcgcggtc
aagctgaagccgctcggcaccggattcgtcggcctgatccggatgatgatcgccccggtg
atcttctgcacgctggtgctcggcgtcggctcgatccggcgcgccgcccaggtgggccgg
gtcggcgggctggccctcggctacttcctgatcatgtccaccgtcgcgctgacgatcggc
ctgatcgtcggcaacatcctgcaccccggcgccggcctgcacctgagccaggaactcgcc
aagaccggcaccgcccaggtgagcagaacggccgagggcggcgtcgacttcgtcctcggg
atcatcccggacaccctgatctccgcgctgaccagcacccaggtgctgcagaccctgctg
gtggcgctgctcgtcggattcgccgtgcagtcgctgggcgcccgcggcgaaccggtgatc
gccgcggtggcgctggcccagcgggtcgtcttcaggatcctcgcgatgatcatgtggctg
gccccgatcggcgcgttcggggcgatggccgccctggtcggcgccaccggcttcgccgcg
ctcaagagcctcgccgcgatcatggtcggcttctacgtgacctgcgcgatcttcgtcttc
ctggtgctcgggctgctgctgcggctggtcgccggagtgtcgatcgggcggctgctgcgc
tacctggcccgcgaattcctgctcatcctgtccacctcgtcgtccgaatcggcgctgccc
cggctgatcgccaaaatggggcacctcggggtgagccgcccggtggtcggcatcgtggtg
cccaccggatactcgttcaacctggacggcaccgcgatctacctgaccatggcgtccctg
ttcatcgccgacgccctcgaccggccgctctccatcggccagcagatcggcctgctgctt
ttcatgatcgtcgcgtccaagggcgccgccggcgtcaccggcgccggcctcgccacgctg
gccggcggcctgcagagccaccggcccgacctggttcccggcgtcggcctgatcgtcggc
atcgaccgcctgatgtccgaggcgagggccctcaccaacttcgccggcaacgcggtggcc
accatcctcatcggcacctggacccacgagatcgaccgcgaccaggcggcccgggtgctg
tccggcgaagcgccgttcgacgaatccaccttcgacgacgacccgcacgccggcggcacc
ccaccacccgccgtcgacgccgcctcccccgcttccgcttccgctccgccttcgccgctc
gccggccctccgaccgccctgtga

DBGET integrated database retrieval system