KEGG   Actinoplanes sp. SE50/110: ACPL_7108Help
Entry
ACPL_7108         CDS       T02044                                 

Definition
(GenBank) dUTP pyrophosphatase
  KO
K01520  
dUTP pyrophosphatase [EC:3.6.1.23]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ACPL_7108
Enzymes [BR:ase01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     ACPL_7108
DNA repair and recombination proteins [BR:ase03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    ACPL_7108
 Prokaryotic Type
    ACPL_7108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7851934..7852410)
Genome map
AA seq 158 aa AA seqDB search
MSDVVIPVRLIDPDLPLPAYAHPGDAGADLVAAQDVEIAPGEWAKIGTGIAVAIPEGFVG
LVHPRSGLAARLGVTVLNAPGTVDAGYRGEILVNLINHDRARAVKISRGDRIAQLVVQRV
ERAAFHVVDSLDDTARGTGGHGSTGGFSEGKAGSDVLP
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgtcgtcatcccggtccggctgatcgacccggatctgccgctgccggcctac
gcacaccccggtgacgccggcgccgacctggtcgcggcgcaggacgtggagatcgcgccg
ggggagtgggccaagatcggcaccggcatcgcggtggccatcccggagggtttcgtcggg
ctggtgcacccccgttccggtctggccgcccgcctcggggtgacggtgctcaacgcgccc
ggtacggtcgacgccggttaccgtggcgaaatcctcgtcaacctgatcaatcacgaccgg
gcgcgggcggtgaagatctcccgcggcgaccggatcgcccaactcgtggtgcagcgggtg
gagcgggcggcgttccacgtggtggactcgctcgacgacaccgcccggggcacgggcggg
cacggctcgaccggtggattcagcgaaggaaaggctggcagtgatgttctcccgtaa

DBGET integrated database retrieval system