KEGG   Actinoplanes sp. SE50/110: ACPL_7109Help
Entry
ACPL_7109         CDS       T02044                                 

Definition
(GenBank) hypothetical protein
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3093
Motif
Other DBs
NCBI-ProteinID: AEV87989
UniProt: G8SGU9
Position
7852504..7853016
Genome map
AA seq 170 aa AA seqDB search
MTPESPARSTPAYQERLGLPWWVWPAGLLIGAILGTEVALALPGLPGWLPYAVLVPLAVL
LPLPLGRLRVAVREGEFLVDDARLPVAVIADVVALDAAGKREALGVGAHPLAFVVQRPWI
GGAVQVLLDDPADPTPYWVVSTRRPVELATALLAVSRPARAGQASSEPAS
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
gtgacacccgagtccccggcccgcagcaccccggcctatcaggaacgcctcggtctgccc
tggtgggtgtggccggcgggcctgctgatcggcgcgatcctgggcaccgaggtggcgctg
gctctgcccgggctgcccggctggctgccgtacgcggtgctcgtcccgctcgcggtcctg
ctcccgctcccgctgggccggctgcgggtggccgtgcgcgagggcgagttcctggtcgac
gacgcgcgactgccggtcgcggtgatcgccgacgtggtggccctggacgcggcgggcaag
cgggaggcgctgggcgtcggcgcgcacccgctggccttcgtggtgcagcgcccgtggatc
ggcggcgcggtgcaggtgctgctcgacgacccggccgaccccacgccgtactgggtggtc
agcacccggcggccggtcgagctggccaccgcgctgctcgcggtcagtcgtccagcgcgg
gccggtcaggcctcgtcagagcccgcttcctga

DBGET integrated database retrieval system