KEGG   Actinoplanes sp. SE50/110: ACPL_7134Help
Entry
ACPL_7134         CDS       T02044                                 

Gene name
cheW
Definition
(GenBank) Chemotaxis protein cheW
  KO
K03408  
purine-binding chemotaxis protein CheW
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ase00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ACPL_7134 (cheW)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ACPL_7134 (cheW)
Bacterial motility proteins [BR:ase02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ACPL_7134 (cheW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7874533..7876089)
Genome map
AA seq 518 aa AA seqDB search
MSVDMDEDADLGEDTADYVTFDMVGERYAFPMRRVQEIIRMPSVVKVPLGPPSLEGLANL
RGRVLPVVNLRQCCSMEQAEHDETTRVIVVDGGVPLGFVVDRVASVISIDPQDLEPGEAV
QATVRSDVLVGVIKSDGGEMTTVLDVDRLIGSQFARLAEKRGPGGRESVTRVSGEADPDA
DLDDTLELVSFAVEGQEYALPIDQVQEIVQAPESVSHVPNAGSRVLGVIDLRGRLLPVVS
MRRVFGLPVTPLEPQNRIVVVSLDDGVVGVVMDTVREVLRVPHQLVAPLPGVVAGEGRKT
EVESVVRLEDGKRLVSVLSVNRMFDSPEVRDEIAGYREDDEEMTAERASEADDGRGDEEL
FVVFRLDDEEYAVDVDAVQEIIRVPEALIRVPKSFSFVEGLVNLRGTVLPVVDLRTRLGL
ERTERDERQRIVVLIIGGVRTGFIVDSVAEVARVGRNVLEPAPELSEEQARVVSRVANLP
DQQRMLLLVQVDQLLAAEQAAVAAELCEDVVSEALAGV
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcgacatggacgaggacgcggacctcggcgaggacaccgcggactacgtcacc
ttcgacatggtgggggagcggtacgccttcccgatgcgccgggtccaggagatcatccgg
atgccctcggtggtgaaggtgccgctcgggccgccgtccctggagggtctggccaacctg
cgcggccgggtgctgccggtggtcaacctgcggcagtgctgctcgatggagcaggccgag
cacgacgagacgacccgggtgatcgtggtcgacggcggcgtgccgctgggcttcgtggtg
gaccgggtggccagcgtgatcagcatcgatccgcaggacctggagccgggcgaggcggtg
caggccacggtccgctcggacgtgctggtcggggtgatcaagtcggacggcggggagatg
accacggtcctcgacgtcgaccggctgatcggcagccagttcgcccggctcgcggagaag
cgcggccccggtggccgggagtcggtgacccgggtgtccggtgaggccgatccggatgcc
gatctggacgacactctggagctggtcagtttcgcggtcgagggccaggagtacgcgctg
ccgatcgaccaggtgcaggagatcgtccaggcgccggagtcggtcagccacgtcccgaac
gccggcagccgggtgctcggtgtgatcgacctgcgcggccggctgctgccggtggtcagc
atgcggcgggtcttcggcctgccggtcaccccgctggagccgcagaaccggatcgtcgtg
gtctccctcgacgacggcgtggtcggcgtggtgatggacaccgtgcgcgaggtgctgcgg
gtgccgcaccagctggtggcgccgctgcccggggtggtggccggggagggccgcaagacc
gaggtggagtcggtggtccggctggaggacggcaaacggctggtctcggtgctgagcgtg
aaccggatgttcgactcacccgaggtgcgtgacgagatcgccggatatcgggaggacgac
gaggagatgaccgccgaacgggccagcgaggccgacgacggccgtggcgacgaggagctg
ttcgtcgtcttccggctcgacgatgaggagtacgcggtcgacgtcgacgccgtgcaggag
atcatccgggtgccggaggcgctgatccgggtgcccaagtccttcagtttcgtggagggg
ctggtcaacctgcgcggcaccgtgctgccggtggtcgacctgcggacccggctgggcctg
gagcgcaccgagcgcgacgagcggcagcggatcgtggtgctgatcatcggcggggtgcgg
accggcttcatcgtcgactcggtggccgaggtggcccgggtcgggcgcaacgtgctggag
ccggctccggaactctccgaggagcaggcgcgcgtggtctcgcgggtggccaacctgccg
gaccagcagcggatgctgctgctcgtgcaggtcgatcagctgctggcggccgagcaggcg
gcggtggcggccgagttgtgcgaggacgtcgtgtccgaggcactcgccggggtctag

DBGET integrated database retrieval system