KEGG   Actinoplanes sp. SE50/110: ACPL_7142Help
Entry
ACPL_7142         CDS       T02044                                 

Gene name
ideR
Definition
(GenBank) Iron-dependent repressor ideR
  KO
K03709  
DtxR family transcriptional regulator, Mn-dependent transcriptional regulator
Organism
ase  Actinoplanes sp. SE50/110
Brite
Transcription factors [BR:ase03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    ACPL_7142 (ideR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
7884868..7885557
Genome map
AA seq 229 aa AA seqDB search
MNDLVDTTEMYLRTILELEEEGVPPLRARIAERLHQSGPTVSQTVARMERDGLLTVEGDR
HLVLTEQGRSTAVSVMRKHRLAELLLVNVIGMPWEEAHEEACRWEHVMSDSVERRVYELL
NKPTRSPYGNPIPGLEQLGLPEDDATLEQPGPGERNLAFPGLTGSVVVRRICESVQTNSD
VLRQLHAAGIDPGTTVTVAQERDGVTIDKAGDKIRLPREVASRVFVAAR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaccttgtcgacaccaccgagatgtatctccggaccatcctcgaactcgaggaa
gaaggcgtgcccccgctgcgcgcgcggatcgccgagcgcctgcaccagagcggtcccacc
gtgagtcagaccgtggcccggatggaacgcgacggcctgctcaccgtcgagggcgaccgc
cacctggtgctgaccgagcagggccgcagcaccgccgtgtcggtcatgcgcaagcaccgg
ctggccgagctgctgctggtcaacgtcatcggcatgccgtgggaggaagcccacgaggag
gcctgccggtgggagcacgtgatgagcgactccgtcgaacgccgggtctatgagctgctc
aacaagccgacccggtcgccgtacggcaacccgatccccggcctggaacaactcggcctg
cccgaggacgacgcgaccctggaacagcccggccccggcgaacgcaacctggccttcccc
gggctgaccggcagcgtcgtggtccggcggatctgcgaaagcgtgcagaccaactccgac
gtgctgcggcagctgcacgccgccgggatcgacccgggcacgacggtgaccgtcgcgcag
gaacgggacggggtcaccatcgacaaggccggcgacaagatcaggctgccgcgtgaggtg
gcatcccgggtgttcgtcgccgcccgctga

DBGET integrated database retrieval system