KEGG   Actinoplanes sp. SE50/110: ACPL_7146Help
Entry
ACPL_7146         CDS       T02044                                 

Gene name
ybjJ
Definition
(GenBank) Inner membrane protein ybjJ
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 DUF3574
Motif
Other DBs
NCBI-ProteinID: AEV88026
UniProt: G8SGY6
Position
complement(7888491..7889672)
Genome map
AA seq 393 aa AA seqDB search
MSSVDVLPARVATARIAVGVTFAMNGLALAGWLSRAPAVRDGLELSVAGFGLLLLCMSGT
SVASIPLAGPLVQRVGPARAVLLASMAMAAGLAVLATATLLGSVVLAGVALLFCGFGTST
WDVAMNVEAADVERRLGRTIMPRFHAGFSLGTVAGAGVGAAASATGVPIGAQLYVTTVIV
VAVQIAVVRRFLPHSGPEPGSRPAMTAGQAWREPRTLLIGLILLGFGFTEGSANDWLAIS
LVDGYHTGDTLGALGFGVFVTAMTLGRMYGGLATDRWGRVPSLRLTALSAAAGILLVVFG
GSVWLALAGALCWGVGASLGFPIGMSAAADDPIRAAMRVSVAGSVGYAAFLAGPPLIGFL
AEHFGVRNALLCVFAALLLGLTASHAAKPLPTS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcgtcgacgtcctgcccgcccgggttgccaccgccaggatcgccgtcggggtg
acgttcgcgatgaacgggttggcgctcgccgggtggctgtcccgggctcccgcggtccgg
gacgggctggagttgtcggtcgccgggttcggcctgctgctgctctgcatgtcgggcacg
tcggtcgcgtcgatcccgctggccggtccgctggtgcagcgggtcgggccggcccgggcg
gtgctgctggccagcatggcgatggcggccggtctggccgtgctggccaccgccaccctg
ctcggctcggtggtgctcgccggggtcgccctgctgttctgcggtttcggcaccagcacg
tgggatgtcgcgatgaacgtcgaggccgccgacgtcgaacgccgcctcggccggaccatc
atgccccgcttccacgccggtttcagcctgggcacggtcgccggcgccggtgtcggtgcg
gccgcgtcggccaccggggtgccgatcggagcccagctgtacgtgaccacggtgatcgtc
gtcgcggtccagatcgccgtggtccgccgtttcctgccacactcgggtccggagccgggc
agccggccggcgatgaccgccgggcaggcttggcgggaaccccgcaccctgctgatcggc
ctgatcctgctcggtttcggcttcaccgagggcagcgccaacgactggctggcgatcagc
ctggtcgacggctaccacaccggcgacacgctgggcgccctgggcttcggcgtcttcgtc
accgcgatgaccctgggccgcatgtacggcggcctggccaccgaccgctggggccgggtc
ccgtccctgcgcctcaccgccctgtccgccgcggccggcatcctgctggtcgtcttcggc
ggctcggtatggctggccctggccggcgccctctgctggggagtcggcgcctccctcggc
ttcccgatcgggatgagcgccgccgccgacgacccgatccgcgccgccatgcgagtgtcc
gtggccggctccgtcggctacgccgccttcctggccggcccacccttgatcggcttcctg
gccgaacacttcggcgtccgcaacgccctcctctgcgtcttcgccgccctcctcctcggc
ctcaccgcctcccacgccgccaagccacttcccaccagctga

DBGET integrated database retrieval system