KEGG   Actinoplanes sp. SE50/110: ACPL_7149Help
Entry
ACPL_7149         CDS       T02044                                 

Gene name
nrdR
Definition
(GenBank) NrdR-like transcriptional regulator
  KO
K07738  
transcriptional repressor NrdR
Organism
ase  Actinoplanes sp. SE50/110
Brite
Transcription factors [BR:ase03000]
 Prokaryotic Type
  Other transcription factors
   Others
    ACPL_7149 (nrdR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7893419..7893991)
Genome map
AA seq 190 aa AA seqDB search
MRLCFGVSGVAVKGEIAVRCPYCRHADSRVVDSREADDGQLIRRRRSCPECGKRFTTVEE
AVLAVVKRSGVTEPFSRTKVMSGVRKACQGRPVDEDSIALLAQRVEEAVRARGAAEIPSH
EVGLAILTPLRELDQVAYLRFASVYKAFDSLDEFEKEIAALREAPPVRDAGTRHAVAPRS
GTARVPRING
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgaggctgtgcttcggcgtgtccggggtagcggtgaagggggagatcgcggtgcgttgc
ccgtactgccggcacgccgattcgcgtgtcgtggactcgcgcgaggccgatgacggtcaa
ctgatccgtcgccgccgctcgtgtcccgagtgcggcaagcggttcaccacggtcgaggag
gcggtgctcgcggtggtcaagcgcagtggcgtcaccgagcccttcagccggaccaaggtc
atgagtggggtgcgcaaggcctgtcagggccggcccgtcgacgaggactcgatcgcgctg
ctcgcgcagcgggtggaggaagccgtccgggcccgcggcgccgcggagatcccgagccac
gaggtcggtctggcgattctcacgcccctgcgtgaactcgaccaggtcgcctatctgcgg
ttcgccagcgtctacaaggccttcgactctctcgacgagttcgagaaggagatcgccgcg
ctccgcgaggcgccacccgtccgggacgccgggacgcgacacgccgtcgcgccgcggtcc
gggacggcccgtgtgcccaggatcaacggctga

DBGET integrated database retrieval system