KEGG   Actinoplanes sp. SE50/110: ACPL_7155Help
Entry
ACPL_7155         CDS       T02044                                 

Gene name
dapF
Definition
(GenBank) diaminopimelate epimerase
  KO
K01778  
diaminopimelate epimerase [EC:5.1.1.7]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ACPL_7155 (dapF)
Enzymes [BR:ase01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     ACPL_7155 (dapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7900547..7901413)
Genome map
AA seq 288 aa AA seqDB search
MMGGVFFTKGHGTANDFVILADPDGELELTPALVAALCDRRRGIGGDGVLRVVRSAKHPA
GAGHATEAEWFMDYWNSDGSIAEMCGNGVRVFARYLTARQLATPGPAGLPVATRAGVVHA
VVDADTISVRMSTPRVYAASTARVGPLTVPGIAVDCGNPHLVCGLHDGVTLSGLDLTTAP
GVDRALFAAGVNVEFVEPVIDPTPDTDRHVRMRVHERGSGETMSCGTGALAVGAVALREA
GLATGSVTVDVLGGRVVITADAAGSWWLAGPAVLVATGEVDLSALPVT
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgatgggcggcgtgtttttcaccaagggccacggcaccgccaacgacttcgtcatcctc
gccgaccccgacggcgaactggagctgacgccggcactggtcgccgcgctctgcgaccgg
cggcgcgggatcggtggcgacggcgtgctgcgcgtggtgcggtccgcgaaacacccggcg
ggggccgggcacgccaccgaggccgagtggttcatggattactggaacagtgacggctcg
atcgccgagatgtgcggcaacggggtccgggtcttcgcccgctatctgaccgctcgtcag
ctggccacgcccgggcccgcgggcctgccggtcgccacccgcgccggcgtcgtgcacgcg
gtggtcgacgccgacacgatcagcgtccggatgagcaccccccgggtgtacgcggcgagc
accgcccgggtcggcccgctgaccgtccccgggatcgccgtcgactgcggcaacccgcac
ctggtctgcgggctgcacgacggggtgacgctgtccggcctggacctgaccaccgccccg
ggggtcgaccgggcgctgttcgccgccggggtgaacgtcgagttcgtcgagccggtcatc
gacccgaccccggacaccgaccgccacgtgcggatgcgggtccacgagcggggctccggc
gagacgatgtcctgcggcaccggggccctcgcggtcggcgcggtggccctgcgcgaggcc
ggcctggccaccggctcggtcaccgtcgacgtcctcggcggccgggtcgtgatcaccgcc
gacgcggccggctcgtggtggctggccggtccggcggtcctggtcgccaccggcgaggtc
gacctgtcggcccttccggtcacctga

DBGET integrated database retrieval system