KEGG   Actinoplanes sp. SE50/110: ACPL_7160Help
Entry
ACPL_7160         CDS       T02044                                 

Gene name
ilvA
Definition
(GenBank) threonine dehydratase
  KO
K01754  
threonine dehydratase [EC:4.3.1.19]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACPL_7160 (ilvA)
   00290 Valine, leucine and isoleucine biosynthesis
    ACPL_7160 (ilvA)
Enzymes [BR:ase01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     ACPL_7160 (ilvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7906315..7907274)
Genome map
AA seq 319 aa AA seqDB search
MELTLADFRAAHAVVRRHLAPTPLGGYPLLDRAAGATVLVKHENAQPVGAFKVRGGLTLL
DALPAADRARGTLTWSTGNHAQSLAYASHRYGVPCTVVMPAGTDPGRAAAVEAWGARVVL
AGDRLEDAQEHAGKLAAETGALAVSPGDTPELLAGVGTLYLEILEREPDLDAIVVPVGSG
TGAAAACLVSAALGARCAVIGVQSAASPAAHDSWRAGELLARPNRSTVAGLATGRGYALP
QRVMRAGLADFLLVGDDEIGAARRLLASAAHTLAEGAGAAALAGVLSRPDLFAGRRIAVV
CSGGNADRAELGTMIDGRG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggagctgaccctcgccgacttccgcgccgcccacgccgtcgtccgccgccacctggcg
cccaccccgctcggcggctacccgctgctggaccgggcggccggcgcgaccgtgctggtc
aagcacgagaacgcgcagccggtcggcgcgttcaaggtgcgcggcggactgaccctgctg
gacgccctgccggccgccgaccgggcccgcgggacgctcacctggtcgaccgggaaccac
gcgcagtcgctggcctacgccagccaccggtacggcgtgccctgcacggtggtgatgccg
gccggcaccgatccgggccgggccgccgcggtcgaggcgtggggcgcccgcgtggtgctg
gccggcgaccgcctggaggacgcccaggagcacgccggcaagctggccgcggagaccggc
gcccttgcggtcagccccggggacacgcccgagctgctggccggggtcggcaccctgtac
ctggagattctggagcgggaaccggacctggacgcgatcgtggttccggtcggcagcggc
accggggcggccgcggcctgcctggtgagcgcggccctgggcgcgcgctgcgcggtgatc
ggcgtgcagtcggccgcctcaccggccgcacacgactcgtggcgggccggcgagttgctc
gcccggcccaaccggtccacggtggccggcctggccaccgggcgcggctacgcgctgccg
cagcgggtgatgcgggccggcctggccgatttcctgctggtcggtgacgacgagatcggg
gcggcccgacgactgctggcgagcgccgcgcacaccctggccgagggggccggcgcggcc
gcgctggccggggtgttgagccggcccgacctgttcgccgggcgccggatcgcggtggtc
tgcagtggaggcaacgccgaccgcgccgaactgggcacgatgatcgatggccgagggtga

DBGET integrated database retrieval system