KEGG   Actinoplanes sp. SE50/110: ACPL_7172Help
Entry
ACPL_7172         CDS       T02044                                 

Gene name
recA
Definition
(GenBank) recombinase A
  KO
K03553  
recombination protein RecA
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ase00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ACPL_7172 (recA)
DNA repair and recombination proteins [BR:ase03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ACPL_7172 (recA)
    RecFOR pathway proteins
     ACPL_7172 (recA)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    ACPL_7172 (recA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7920266..7921351)
Genome map
AA seq 361 aa AA seqDB search
MAKNAKSNTGVTAMVAAPDREKALELALAQIDKQFGKGSVMRLGERPVVQTAVIPTSSIA
LDVALGVGGLPRGRVIEVYGPESSGKTTVALHAVANAQKAGGTAAFIDAEHALDPDYARA
LGVDTDALLVSQPDTGEQALEIADMLIRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGL
QARLMSQALRKITGVLNNTGTTAIFINQLREKIGVMFGSPETTTGGRALKFYASVRLDVR
RIESLKDGTDVVGNRTRVKVVKNKVAAPFKQAEFDIMYGKGISREGSLIDVGVEQSIIRK
SGAWYTYDGDQLGQGKEKAREFLKENPDVAAEIEKKILEKLGVGQTSGDAAGGPELPPVD
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaagaacgcgaagtccaatacaggggtgacagcaatggtggcagcaccggaccgg
gaaaaggcgctcgaactggcgctggcacagatcgacaagcagttcggcaagggctcggtg
atgcggctcggtgagcggccggtcgtgcagaccgccgtgatcccgaccagctcgatcgcg
ctcgacgtggcgctcggcgtcggcggcctgccgcgtggccgggtcatcgaggtgtacggg
ccggagtccagcggtaagaccaccgtcgcactgcacgcggtggccaacgcgcagaaggcc
ggcggcaccgcggcgttcatcgacgcggagcacgcgctcgacccggactacgcgcgggct
ctcggcgtcgacaccgacgccctgctggtgtcccagccggacaccggcgagcaggcgctg
gagatcgcggacatgctgatccgctccggtgcgctcgacatcatcgtcatcgactcggtc
gccgccctggtgccgcgcgccgagatcgagggcgagatgggtgacagccatgtcggtctg
caggcccggctgatgagccaggcgctccgcaagatcaccggcgtgctcaacaacaccggc
accacggcgatcttcatcaaccagctccgcgagaagatcggcgtgatgttcggctcgccg
gagacgacgaccggtggtcgcgcgctgaagttctacgcctcggtccggctcgacgtgcgc
cgcatcgagagcctgaaggacggcaccgacgtggtcggtaaccgcacccgggtcaaggtc
gtgaagaacaaggtcgcggccccgttcaagcaggccgagttcgacatcatgtacggcaag
ggcatctcccgcgagggctcgctcatcgacgtgggtgtcgagcagagcatcatccgcaag
tccggcgcctggtacacgtatgacggcgaccagctcggccagggcaaggagaaggcgcgg
gagttcctcaaggagaacccggacgtcgccgccgagatcgagaagaagatcctggagaag
ctcggcgtcgggcagacctccggggacgctgccggtggccccgagctgccgccggtcgac
ttctga

DBGET integrated database retrieval system