KEGG   Actinoplanes sp. SE50/110: ACPL_7174Help
Entry
ACPL_7174         CDS       T02044                                 

Definition
(GenBank) DNA polymerase bacteriophage-type
  KO
K21929  
uracil-DNA glycosylase [EC:3.2.2.27]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ase00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    ACPL_7174
Enzymes [BR:ase01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     ACPL_7174
DNA repair and recombination proteins [BR:ase03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     ACPL_7174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7922169..7922834)
Genome map
AA seq 221 aa AA seqDB search
MSRTGGPVGAQQWVPPRPHSIDELKQAAAGCHGCELYENATQTVFGRGAPNAKIVFVGEQ
PGDIEDQKGLPFVGPAGRLLRDAVDDAGIDPADLYITNSVKHFRFELRGARRIHQSPGPA
HITACRPWLVSEFALLKPQLVVLLGATAGKALLGPSFRVNRSRGQLMPWPASAEHPEDFP
VAEIRALATIHPSAVLRADNRDIAYQGLVDDLKIAAAAITA
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcacggaccggaggtccggtcggcgcacagcaatgggtgccaccgcggccgcacagc
atcgacgaactcaagcaggccgcagccgggtgtcacggctgtgagctctacgagaacgcc
acccagacggtcttcggccggggcgccccgaacgcgaagatcgtcttcgtaggtgagcag
cccggtgacatcgaggaccagaagggcctgccgttcgtcggcccggccggccggctgctc
cgcgacgccgtggacgatgccggcatcgaccccgccgacctctacatcaccaactcggtc
aagcatttccggttcgagctgcgcggtgcccggcgcatccaccagagtcccgggccggcc
cacatcaccgcctgccgtccctggctggtgagcgagttcgccctgctgaagccgcagctc
gtggtcctgctcggagcaaccgcgggcaaggcgctgctgggcccgtcgttccgggtgaac
cggtcccgcggccagctgatgccctggccggcctccgccgagcatcccgaggactttccg
gtggccgagatcagggcgctggccacgatccacccctcggcggttctccgagcggacaac
cgggacatcgcctatcagggcctggtcgacgacctgaagatcgccgccgccgcgatcacc
gcctga

DBGET integrated database retrieval system