KEGG   Actinoplanes sp. SE50/110: ACPL_7184Help
Entry
ACPL_7184         CDS       T02044                                 

Definition
(GenBank) Laminin subunit beta-1
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7938157..7939020)
Genome map
AA seq 287 aa AA seqDB search
MANPFVKGWHYMMALFGAKIDEYADPKVQIQQAIEDAQRQHQALVQQAAAVIGNQRQLEM
KLSRQMSEVEKLQGMARQALVLADRARAAGDEAEAQKYEQTAQTLATQLVSGEQSMEDLK
TLHDQALGAAGQARKAVENNAMVLQQRIAERSRLLSQLEQAKMQETVAKSLESMSQLAAP
GNTPSLDQVRDKIEQRYASAMGRAELASNSVEGRMLEVQKSSLDLAGSSRLEQIRASMAG
DKLGGAAAQPAVGGQQNATPADAAGVARLDEIRASMNQKRGDTTAAG
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacccgttcgtcaagggctggcattacatgatggcgctcttcggcgcgaaaatt
gacgagtacgccgacccgaaggtgcagatccagcaggccatcgaggatgcgcagcggcag
caccaggcccttgtccagcaggccgcggccgtcatcggcaaccagcggcagctcgagatg
aagctgtcccgccagatgtccgaggtcgagaaactgcagggcatggcgcggcaggcgctc
gtgctggccgaccgggcccgggccgccggcgacgaggccgaggcgcagaagtacgagcag
acggcgcagaccctggccacccagctggtctccggcgagcagtcgatggaagatctgaag
acgctgcacgaccaggccctcggcgccgccggtcaggcccgcaaggccgtcgagaacaac
gcgatggtgctgcagcagcgcatcgccgagcggtcccgcctgctcagccagctggagcag
gccaagatgcaggaaaccgtggccaagtcgctggagtcgatgtcgcagctggccgcgccg
ggcaacacgccgtcgctggaccaggtgcgcgacaagatcgagcagcggtacgcgagcgcg
atgggccgcgccgagctggcgtccaactcggtcgagggccgcatgctcgaggtgcagaag
tccagcctggacctggccggctcgtcccgcctggagcagatccgggccagcatggccggc
gacaagctgggcggcgcggccgcccagccggcggtcggcggtcagcagaacgccacgccg
gccgacgcggcgggggtggcgcggctcgacgagatccgcgccagcatgaaccagaagcgc
ggcgacaccacggccgccggctga

DBGET integrated database retrieval system