KEGG   Actinoplanes sp. SE50/110: ACPL_7188Help
Entry
ACPL_7188         CDS       T02044                                 

Definition
(GenBank) MiaB-like tRNA modifying enzyme YliG
  KO
K14441  
ribosomal protein S12 methylthiotransferase [EC:2.8.4.4]
Organism
ase  Actinoplanes sp. SE50/110
Brite
Enzymes [BR:ase01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.4  Transferring alkylthio groups
    2.8.4.4  [ribosomal protein S12] (aspartate89-C3)-methylthiotransferase
     ACPL_7188
Ribosome biogenesis [BR:ase03009]
 Prokaryotic Type
  ribosomal protein modification factors
   ACPL_7188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(7941204..7942664)
Genome map
AA seq 486 aa AA seqDB search
MSVTPPPSRRVALLTLGCARNEVDSEELAARLDAEGWEVGTDAAKADVVLVNTCGFVEKA
KQDSIDTLLAAADTGAKVVAAGCMAERYGRELAENLPEADAVLGFDDYTDIATRLNGVLA
GEKFDAHTPRDRRELLPITPVQRHAAKVVVPGHATVDEHTPAHLRKVLRRRLDNSPVASL
KLASGCDRRCAFCAIPAFRGAFVSRDPQELLAEAEWLARTGVRELVLVSENSTSYGKDLG
DPRLLEKLLPQLAAVDGIVRVRASYLQPAETRPGLVEAIAGTPGVAAYYDLSFQHSSEPV
LRRMRRFGSTERFLELLDSARRLAPEAGARSNFIVGFPGETRQDVDELVRFLTEARLDAI
GIFDYSDEDGTEAAGLPGKVRPETVKRRYDRVVALAEELCAQRAEDRLGSIVEVLVDTID
DGEIEGRAEHQAPEVDGSTTLVAGDQGVDLAALRPGDLVRARVTGTEGVDLIAVPTEMIS
AAQADR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgtaactcctcctccttctcgccgtgtcgccctcctcaccctgggctgtgcccgt
aacgaggtcgactcggaagagctcgccgcccgcctcgacgccgagggctgggaggtcggc
accgacgcggcgaaagccgacgtggtgctcgtcaacacctgcggcttcgtggagaaggcg
aaacaggactcgatcgacaccctgctcgccgcggccgacaccggcgccaaggtggtcgcc
gccggctgcatggccgagcggtacggccgggagctcgcggagaacctgcccgaggccgac
gcggtgctcggcttcgacgactacaccgacatcgccacccggctgaacggggtgctggcc
ggcgagaaattcgacgcgcacaccccgcgggaccgccgcgagctgctgccgatcaccccg
gtgcagcggcacgcggccaaggtggtcgtccccggccacgcgaccgtcgacgagcacacc
ccggcccacctgcgcaaggtgctgcgccgccggctcgacaacagcccggtcgcctcgctc
aaactggccagcggctgcgaccggcgctgcgcgttctgcgcgatcccggcgttccgtggc
gcgttcgtctcccgcgacccgcaggagctgctcgccgaggccgagtggctggcccggacc
ggcgttcgcgagctcgtcctggtgagcgagaactccacgtcgtacggcaaggatctgggc
gacccgcgcctgctggagaaactgctcccgcagctggccgcggtcgacggcatcgtccgg
gtccgggcgagctatctgcagcccgccgagacccgccccggcctggtcgaggcgatcgcc
ggcacgcccggcgtcgcggcctactacgacctgtccttccagcactccagcgagccggtg
ctgcgccggatgcgccggttcggctccaccgagcgcttcctggagctgctcgactcggcg
cgccggctggccccggaggccggtgcccggagcaacttcatcgtcggcttccccggcgag
acccggcaggacgtggacgagctggtccgcttcctgaccgaggcgcgcctcgacgcgatc
ggcatcttcgactacagcgacgaggacggcaccgaggccgccggcctgcccggcaaggtc
cgcccggagaccgtcaagcggcggtacgaccgggtggtggcgctcgccgaggagctctgc
gcccagcgcgccgaggaccggctcggcagcatcgtcgaggtgctcgtcgacacgatcgac
gacggcgagatcgagggccgggccgagcaccaggcccccgaggtggacggctccaccacg
ctggtcgccggcgaccagggggtcgacctggccgcgctgcgccccggcgacctggtgcgt
gcccgggtcaccggcaccgagggggtcgacctgatcgccgtgcccaccgagatgatctcc
gccgcgcaggccgaccggtga

DBGET integrated database retrieval system