KEGG   Actinoplanes sp. SE50/110: ACPL_7189Help
Entry
ACPL_7189         CDS       T02044                                 

Definition
(GenBank) hypothetical protein
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_20 TrmB FaeA MarR_2
Motif
Other DBs
NCBI-ProteinID: AEV88069
UniProt: G8SIB5
Position
7942753..7943412
Genome map
AA seq 219 aa AA seqDB search
MTTSEDLGDLDAVTSLADGVRRQAYRTVAASRAPVGRDEVAEALGVGRTLAAFHLDKLVA
AGLLETSYARRSGRTGPGAGRPAKLYRVATAEHVVSVPPRAYRTAAELLAEALEETGAEE
TLNRVARRHGERAAAAEGDVFEVLAGHGYGPVADGPERIELRNCPFHRLAEQFPPVICGM
NLAMVDGLLTGAGLDAGWQARMDAAPGRCCVALCKKQTD
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacttcggaggacctcggcgatctcgacgcggtgaccagcctcgccgacggcgtg
cggcggcaggcgtaccggacggtggccgcgtcccgcgccccggtcggacgcgacgaggtg
gccgaggcgctcggggtcgggcgcacgctggccgcgttccacctggacaagctggtggcc
gccgggctgctggagacgtcgtacgcgcgccggtcgggccgtaccgggccgggcgccgga
cggccggcgaagctgtaccgggtggccaccgccgagcacgtggtcagcgtgccgccgcgt
gcctaccgcacggcggccgagctgctggccgaggcactggaggagaccggcgccgaggag
acgctgaaccgggtggcccgccgtcacggcgagcgggccgcggcggccgagggggacgtg
ttcgaggtgctggccgggcacggctacggcccggtggcggacggcccggagcggatcgag
ctgcggaactgcccgttccaccggctggccgagcagttccccccggtgatctgcgggatg
aacctggccatggtcgacggcctgctgaccggcgccggcctggacgccgggtggcaggcc
cggatggacgccgcccccggccgctgctgtgtcgctctgtgtaaaaagcaaactgattga

DBGET integrated database retrieval system