KEGG   Actinoplanes sp. SE50/110: ACPL_728Help
Entry
ACPL_728          CDS       T02044                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ase01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ase00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(720694..721815)
Genome map
AA seq 373 aa AA seqDB search
MGRVREVVTGARRIVVKVGSSSLTTAAGGIDEQRLDSLVDALGRLAGAGREVVLVSSGAI
AAGLAPLQLPRRPRDLATQQAAAAVGQGLLIGRYTAGFARHGRTVAQVLLTVDDVTRRSH
YRNAYQTLRKLLDLGALPIVNENDTVATEEIRFGDNDRLAALVAALVDADLLVLLSDVDA
LYTGSPSDPASRRIPLVRDDADLAGVAIGSAGRSGVGTGGMVTKVEAARIATGFGIPVVL
TAAPLAADALTGAEVGTLFQAAESRPTARLFWLAHATAPRGRLHLDAGAVTAVVARRKSL
LPAGITAVDGSFAAGDPVDLVDAGSGAPVARGLVNYDAVELPALLGRSTPELAAALGPGY
EREVVHRDDLVLL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgggccgggtgcgggaagtggtgaccggtgcgcgccggatcgtggtcaaggtggggtcg
tcctcgctgaccaccgcggcgggcggcatcgatgagcagcggctggattccctggtcgac
gcgctgggccggttggccggcgcgggccgtgaggtggtgctggtctccagcggcgcgatc
gccgccggcctggccccgctgcagctgccgcgccggccgcgtgacctggccacccagcag
gccgccgccgcggtcggccaaggcctgttgatcgggcgctacaccgccggtttcgcccgg
cacggccggaccgtcgcgcaggtgctgctcaccgtcgacgacgtgacccgccgctcgcac
taccgcaacgcctaccagacgctgcgcaaactgctggatctcggcgccctgccgatcgtc
aacgagaacgacacggtggccaccgaggagatccgcttcggggacaacgaccggctggcc
gcgctggtcgccgccctggtcgacgccgacctgctggtgctgctctccgacgtggacgcg
ctctacaccggcagcccgtccgacccggcctcgcgccggatcccgctggtccgcgacgac
gccgacctggcgggggtggcgatcggctcggccggccggtccggggtcggcaccggcggc
atggtgaccaaggtggaggcggcccggatcgccaccgggttcggcatcccggtggtgctg
accgccgccccgctggccgccgacgcgctgaccggcgccgaggtcggcaccctgttccag
gccgccgagtcgcggccgaccgcccggctgttctggctggcgcacgccaccgcgccgcgc
ggccgcctgcacctggacgcgggcgcggtcaccgcggtggtggcccgacgcaagtcgctg
ctgccggccgggatcaccgcggtggacggttccttcgccgccggcgacccggtggacctg
gtcgacgccggctcgggcgccccggtcgcgcgcggcctggtcaactatgacgcggtcgag
ctgccggcgctgctcggccggtccactccggagttggcggccgcgctcggcccgggctat
gaacgagaggtcgttcaccgcgacgacctcgtactgctgtga

DBGET integrated database retrieval system