KEGG   Actinoplanes sp. SE50/110: ACPL_7356Help
Entry
ACPL_7356         CDS       T02044                                 

Definition
2-isopropylmalate synthase (EC:2.3.3.13)
Orthology
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:ase01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ase01230]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ase00620]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:ase00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8120792..8122366
Genome map
AA seq 524 aa AA seqDB search
MDYQVFDTTLRDGGQREGISYTVADKLAVARLLDDFGVGFIEGGWPGAMPKDTEFFARAR
TELNLRHAVLVAFGATRKAGVDVAADPQVRALLEADTPVVCVVAKSDIRHVERALRTTAE
ENLAMVRDTVRHLVANGRRAFLDCEHFFDGFRFDPEYTASVVRTAIDAGAERVIMCDTNG
GMLPSMITKAITEVVERTGVSADRLGIHCQNDTACAVANTVAAVEAGVRHFQCTANGYGE
RPGNADLFAVVSNLQLKLGLKVLPDGCLEKATRVSSALAEIANIAPDTHQAYVGAAAFAH
KAGLHASAIKVDPLLYNHVDPAVVGNDMRILVTEMAGRASIELKSRELGIDLAGHPDTLT
SVTQKVKDLEAAGWSFEAADASFELLVRSELPGEDVTRPFTLESYRVLVEHREDGKVISE
ATVKLRVKGERVIATAEGNGPVNALDEALRTALSHHHPALRSFELNDYKVRILEGSHGTN
AITRVLVETGDHNREWTTVGVHENVVEASWTALVDALTYGLGRS
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggactaccaggtgttcgacacgacgctgcgcgacggtgggcagcgcgagggaatcagc
tacacggtcgccgacaaactcgcggtcgcacgcctgctggacgacttcggtgtcggtttc
atcgagggcggctggccgggcgcgatgcccaaggacaccgagttcttcgcccgcgccagg
accgagctgaacctccggcacgcggtgctggtcgcgttcggcgccacccgcaaggccggc
gtggacgtggcggccgacccgcaggtgcgggcgctgctggaggccgacaccccggtggtc
tgcgtggtggccaagtcggacatccggcacgtggagcgggcgctgcgcaccacggcggag
gagaacctggcgatggtccgggacacggtccggcacctggtcgccaacggccgccgggcg
ttcctcgactgtgagcacttcttcgacggcttccgtttcgacccggagtacaccgcgagc
gtggtgcggaccgcgatcgacgccggcgccgaacgcgtgatcatgtgcgacaccaacggc
ggcatgctcccctcgatgatcaccaaggcgatcaccgaggtcgtcgagcggaccggggtg
agcgccgaccggctcggcatccactgccagaacgacaccgcctgcgcggtcgcgaacacg
gtcgccgcggtcgaggccggggtgcggcacttccagtgcaccgcgaacggctacggcgag
cgccccggcaacgccgacctgttcgccgtggtcagcaacctgcaactcaagctcgggctg
aaggtcctaccggacggatgcctggagaaggcgacgcgggtctcctccgcgctcgccgag
atcgccaacatcgcccccgacacccaccaggcctatgtcggggccgcggcgttcgcccac
aaggcgggcctgcacgcgagcgcgatcaaagtggatccgctgctgtacaaccacgtcgac
ccggcggttgtcggcaacgacatgcggatcctggtgaccgagatggccggccgggccagc
atcgagctcaagagtcgcgagctcggcatcgacctggccggccatccggacacgctcacc
tcggtcacccagaaggtcaaggacctggaggcggccggctggtcgttcgaggccgccgac
gcctcgttcgagctgctggtgcgcagcgagctgccgggcgaggacgtgacccgcccgttc
accctggagtcgtaccgggtgctggtcgagcaccgcgaagacggcaaggtgatctccgag
gcgacggtgaagctgcgggtcaagggcgagcgggtgatcgccacggccgagggcaacggc
ccggtcaacgcgctggacgaggcgctgcgcaccgcgctctcccaccaccatccggcgctg
aggtcgttcgagctcaacgactacaaggtacggatcctggagggcagccacggcaccaac
gcgatcacccgggtgctggtcgagaccggcgaccacaaccgcgagtggaccaccgtcggc
gtgcacgagaacgtggtcgaggccagctggaccgccctggtcgacgcgctcacctacgga
ctcggcaggagctga

DBGET integrated database retrieval system