KEGG   Actinoplanes sp. SE50/110: ACPL_7356Help
Entry
ACPL_7356         CDS       T02044                                 

Definition
(GenBank) 2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00290  Valine, leucine and isoleucine biosynthesis
ase00620  Pyruvate metabolism
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
ase01210  2-Oxocarboxylic acid metabolism
ase01230  Biosynthesis of amino acids
Module
ase_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACPL_7356
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ACPL_7356
Enzymes [BR:ase01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     ACPL_7356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like LeuA_dimer MEDS
Motif
Other DBs
NCBI-ProteinID: AEV88236
UniProt: G8SL31
Position
8120792..8122366
Genome map
AA seq 524 aa AA seqDB search
MDYQVFDTTLRDGGQREGISYTVADKLAVARLLDDFGVGFIEGGWPGAMPKDTEFFARAR
TELNLRHAVLVAFGATRKAGVDVAADPQVRALLEADTPVVCVVAKSDIRHVERALRTTAE
ENLAMVRDTVRHLVANGRRAFLDCEHFFDGFRFDPEYTASVVRTAIDAGAERVIMCDTNG
GMLPSMITKAITEVVERTGVSADRLGIHCQNDTACAVANTVAAVEAGVRHFQCTANGYGE
RPGNADLFAVVSNLQLKLGLKVLPDGCLEKATRVSSALAEIANIAPDTHQAYVGAAAFAH
KAGLHASAIKVDPLLYNHVDPAVVGNDMRILVTEMAGRASIELKSRELGIDLAGHPDTLT
SVTQKVKDLEAAGWSFEAADASFELLVRSELPGEDVTRPFTLESYRVLVEHREDGKVISE
ATVKLRVKGERVIATAEGNGPVNALDEALRTALSHHHPALRSFELNDYKVRILEGSHGTN
AITRVLVETGDHNREWTTVGVHENVVEASWTALVDALTYGLGRS
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggactaccaggtgttcgacacgacgctgcgcgacggtgggcagcgcgagggaatcagc
tacacggtcgccgacaaactcgcggtcgcacgcctgctggacgacttcggtgtcggtttc
atcgagggcggctggccgggcgcgatgcccaaggacaccgagttcttcgcccgcgccagg
accgagctgaacctccggcacgcggtgctggtcgcgttcggcgccacccgcaaggccggc
gtggacgtggcggccgacccgcaggtgcgggcgctgctggaggccgacaccccggtggtc
tgcgtggtggccaagtcggacatccggcacgtggagcgggcgctgcgcaccacggcggag
gagaacctggcgatggtccgggacacggtccggcacctggtcgccaacggccgccgggcg
ttcctcgactgtgagcacttcttcgacggcttccgtttcgacccggagtacaccgcgagc
gtggtgcggaccgcgatcgacgccggcgccgaacgcgtgatcatgtgcgacaccaacggc
ggcatgctcccctcgatgatcaccaaggcgatcaccgaggtcgtcgagcggaccggggtg
agcgccgaccggctcggcatccactgccagaacgacaccgcctgcgcggtcgcgaacacg
gtcgccgcggtcgaggccggggtgcggcacttccagtgcaccgcgaacggctacggcgag
cgccccggcaacgccgacctgttcgccgtggtcagcaacctgcaactcaagctcgggctg
aaggtcctaccggacggatgcctggagaaggcgacgcgggtctcctccgcgctcgccgag
atcgccaacatcgcccccgacacccaccaggcctatgtcggggccgcggcgttcgcccac
aaggcgggcctgcacgcgagcgcgatcaaagtggatccgctgctgtacaaccacgtcgac
ccggcggttgtcggcaacgacatgcggatcctggtgaccgagatggccggccgggccagc
atcgagctcaagagtcgcgagctcggcatcgacctggccggccatccggacacgctcacc
tcggtcacccagaaggtcaaggacctggaggcggccggctggtcgttcgaggccgccgac
gcctcgttcgagctgctggtgcgcagcgagctgccgggcgaggacgtgacccgcccgttc
accctggagtcgtaccgggtgctggtcgagcaccgcgaagacggcaaggtgatctccgag
gcgacggtgaagctgcgggtcaagggcgagcgggtgatcgccacggccgagggcaacggc
ccggtcaacgcgctggacgaggcgctgcgcaccgcgctctcccaccaccatccggcgctg
aggtcgttcgagctcaacgactacaaggtacggatcctggagggcagccacggcaccaac
gcgatcacccgggtgctggtcgagaccggcgaccacaaccgcgagtggaccaccgtcggc
gtgcacgagaacgtggtcgaggccagctggaccgccctggtcgacgcgctcacctacgga
ctcggcaggagctga

DBGET integrated database retrieval system