KEGG   Actinoplanes sp. SE50/110: ACPL_7356Help
Entry
ACPL_7356         CDS       T02044                                 

Definition
2-isopropylmalate synthase (EC:2.3.3.13)
Orthology
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    ACPL_7356
   01230 Biosynthesis of amino acids
    ACPL_7356
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACPL_7356
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    ACPL_7356
Enzymes [BR:ase01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     ACPL_7356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8120792..8122366
Genome map
AA seq 524 aa AA seqDB search
MDYQVFDTTLRDGGQREGISYTVADKLAVARLLDDFGVGFIEGGWPGAMPKDTEFFARAR
TELNLRHAVLVAFGATRKAGVDVAADPQVRALLEADTPVVCVVAKSDIRHVERALRTTAE
ENLAMVRDTVRHLVANGRRAFLDCEHFFDGFRFDPEYTASVVRTAIDAGAERVIMCDTNG
GMLPSMITKAITEVVERTGVSADRLGIHCQNDTACAVANTVAAVEAGVRHFQCTANGYGE
RPGNADLFAVVSNLQLKLGLKVLPDGCLEKATRVSSALAEIANIAPDTHQAYVGAAAFAH
KAGLHASAIKVDPLLYNHVDPAVVGNDMRILVTEMAGRASIELKSRELGIDLAGHPDTLT
SVTQKVKDLEAAGWSFEAADASFELLVRSELPGEDVTRPFTLESYRVLVEHREDGKVISE
ATVKLRVKGERVIATAEGNGPVNALDEALRTALSHHHPALRSFELNDYKVRILEGSHGTN
AITRVLVETGDHNREWTTVGVHENVVEASWTALVDALTYGLGRS
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggactaccaggtgttcgacacgacgctgcgcgacggtgggcagcgcgagggaatcagc
tacacggtcgccgacaaactcgcggtcgcacgcctgctggacgacttcggtgtcggtttc
atcgagggcggctggccgggcgcgatgcccaaggacaccgagttcttcgcccgcgccagg
accgagctgaacctccggcacgcggtgctggtcgcgttcggcgccacccgcaaggccggc
gtggacgtggcggccgacccgcaggtgcgggcgctgctggaggccgacaccccggtggtc
tgcgtggtggccaagtcggacatccggcacgtggagcgggcgctgcgcaccacggcggag
gagaacctggcgatggtccgggacacggtccggcacctggtcgccaacggccgccgggcg
ttcctcgactgtgagcacttcttcgacggcttccgtttcgacccggagtacaccgcgagc
gtggtgcggaccgcgatcgacgccggcgccgaacgcgtgatcatgtgcgacaccaacggc
ggcatgctcccctcgatgatcaccaaggcgatcaccgaggtcgtcgagcggaccggggtg
agcgccgaccggctcggcatccactgccagaacgacaccgcctgcgcggtcgcgaacacg
gtcgccgcggtcgaggccggggtgcggcacttccagtgcaccgcgaacggctacggcgag
cgccccggcaacgccgacctgttcgccgtggtcagcaacctgcaactcaagctcgggctg
aaggtcctaccggacggatgcctggagaaggcgacgcgggtctcctccgcgctcgccgag
atcgccaacatcgcccccgacacccaccaggcctatgtcggggccgcggcgttcgcccac
aaggcgggcctgcacgcgagcgcgatcaaagtggatccgctgctgtacaaccacgtcgac
ccggcggttgtcggcaacgacatgcggatcctggtgaccgagatggccggccgggccagc
atcgagctcaagagtcgcgagctcggcatcgacctggccggccatccggacacgctcacc
tcggtcacccagaaggtcaaggacctggaggcggccggctggtcgttcgaggccgccgac
gcctcgttcgagctgctggtgcgcagcgagctgccgggcgaggacgtgacccgcccgttc
accctggagtcgtaccgggtgctggtcgagcaccgcgaagacggcaaggtgatctccgag
gcgacggtgaagctgcgggtcaagggcgagcgggtgatcgccacggccgagggcaacggc
ccggtcaacgcgctggacgaggcgctgcgcaccgcgctctcccaccaccatccggcgctg
aggtcgttcgagctcaacgactacaaggtacggatcctggagggcagccacggcaccaac
gcgatcacccgggtgctggtcgagaccggcgaccacaaccgcgagtggaccaccgtcggc
gtgcacgagaacgtggtcgaggccagctggaccgccctggtcgacgcgctcacctacgga
ctcggcaggagctga

DBGET integrated database retrieval system