KEGG   Actinoplanes sp. SE50/110: ACPL_7406Help
Entry
ACPL_7406         CDS       T02044                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ACPL_7406 (rbsK)
Enzymes [BR:ase01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ACPL_7406 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8188959..8189852)
Genome map
AA seq 297 aa AA seqDB search
MPPRVVVVGSANMDLVGLAATLPRPGETVLGDDFVMTPGGKGANQAIAAARAGAATTFLG
AIGSDAFGVTLGARLAATGVDMAHVRTSYGPSGVAVIMVDRAGENSILVSPGANRTFVDL
TEAERACIAGADVLLCQQEIPAGTVAAALAAARAAGTRTILNAAPARELWPSVLDLVDLL
VVNETEARALTDITDSSAMSGLLALVPRVVLTLSGNGSRYADRDGTDVHVPAFPVEVADT
TAAGDAFTGALAVAWAEGRALVEAVRWANAAGAACVRKVGASNALPERAEIEAIFAG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgccaccccgggtggtggtcgtcggcagcgccaacatggacctggtcggcctggccgcg
accctcccgcggcccggcgagacggtgctcggcgacgacttcgtgatgacccccggcggc
aagggcgccaatcaggcgatcgccgcggcccgggccggcgccgccacgacgttcctgggc
gcgatcggctccgacgcgttcggcgtgacgctcggcgcccggctggccgcgaccggggtc
gacatggcccacgtgcgcacgagttacggcccgtccggcgtcgcggtgatcatggtggac
cgggcgggggagaactcgatcctggtcagcccgggggccaaccggacgttcgtggacctg
accgaggcggagcgggcctgcatcgccggggccgacgtgctgctctgtcagcaggagatc
ccggccgggacggtggcggcggcactggccgcggcccgggccgccgggacgcggacgatc
ctgaacgcggcgcccgcgcgggagttgtggccctccgtgctggacctggttgatttgctg
gtggtcaacgagaccgaggcccgggccctcaccgacatcaccgattcctcggcgatgtcc
ggcttgctggcgctggtgccgcgggtggtgctcacgctcagcggcaacggctcccgttac
gccgaccgggacggcaccgacgtgcacgtgccggccttcccggtcgaggtcgccgacacc
acggcggcgggcgacgcgttcaccggcgccctcgcggtcgcctgggcggagggccgcgct
ctggtcgaggcggtgcgctgggcgaacgccgccggcgcggcctgtgtgcgcaaggtcggc
gccagcaacgccctgccggaacgggccgagatcgaagcgatcttcgccggctga

DBGET integrated database retrieval system