KEGG   Actinoplanes sp. SE50/110: ACPL_7409Help
Entry
ACPL_7409         CDS       T02044                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ase00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ase00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8192081..8193766
Genome map
AA seq 561 aa AA seqDB search
MAIDPGLRRLALRTLLAAFPGTSAPDWALDLLADGLAGHTLFGTNVGSSDELSQLTARLR
SARPDALIAIDEEGGDVTRLGHRTGSPYPGNAALGAADDLDLTRQVYAAIGADLATAGVN
LDLAPTVDVNSVAENPIIGTRSFGADPGLVARHTGAAIAGLQSAGVAACAKHFPGHGATV
TDSHLDLPTVDVPLPVLRERDLPPFAAAVAAGARAVMSAHIRVPALTGDGPATFSRAALQ
GLLRDEYGFAGVIVTDALEMRGAAGAAGGIPQAAVAALAAGADLLCIGAEVDRELVLAVA
DEVAAAVGDGRLAVVRLEQAAARNADLAAWAAHQRITRPAATTATAPGRTAVTVPPAPGR
ISATVPPAPDRIPATVPPAPDRIPATVPPAPDRTAATVATTSAAPGRTAATTSAELGRTA
ARRALLVEGDPAALAAPLVVQLGSGYSIAEGKLPWGLRPFLGAVEQIDVNAAETSADELI
ARAAGRPIVLVGRRVHQAAASRELAEKLAAAWPVAVVEMGWPSTWRPDGARAFLVTHGAS
LASAEVAAAALGLITERYDGV
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgacccggggctccgccgcctcgccctgcgcaccctgctcgccgccttcccc
gggacgtccgccccggactgggcactggatctgctcgccgacggcctcgcaggacacacc
ctcttcggcaccaatgtcggttcatccgacgaattatcccagctcaccgcgcggttgcgg
tcggctcgcccggacgcgctgatcgcgatcgacgaggagggcggcgacgtcacccggctc
ggccaccggaccggcagcccctacccgggcaacgccgcgctgggcgccgccgacgacctc
gacctcacccggcaggtgtacgccgcgatcggcgccgacctggccaccgccggagtgaac
ctcgacctggcgccgaccgtcgacgtgaactcggtggccgagaacccgatcatcggcacc
cgctcgttcggcgcggaccccggactggtcgcccggcacaccggcgccgcgatcgccggc
ctgcagtcggccggagtggccgcgtgtgccaaacattttccgggccatggcgcgaccgtg
accgattctcatctcgatcttccgaccgtcgacgtgccgcttccggtgctgcgggagcgg
gatctccccccgttcgcggcggccgtcgcggccggcgcgcgggcggtgatgagcgcacac
atccgggtgccggcgctgaccggcgacgggccggcgacgttcagccgggccgcgctgcag
ggtctgctccgcgacgagtacgggttcgcgggcgtgatcgtgaccgacgccctggagatg
cgcggcgcggccggcgccgcgggcgggatcccgcaggccgcggtcgccgccctcgcggcc
ggcgccgacctgctctgcatcggcgcggaggtggacagggagctggtgctcgcggtcgcc
gacgaggtcgcggccgcggtcggtgacggccggctcgcggtcgtacgtcttgagcaggcg
gccgcccgcaacgccgacctcgccgcctgggcggcacaccagcggatcacccgccccgcc
gcgaccaccgcaaccgcaccgggccgcaccgccgtaaccgtcccacctgcgccgggccgc
atctccgcaaccgtcccacctgcgccggaccgcatccccgcaaccgtcccacctgcgccg
gaccgcatccccgcaaccgtcccacctgcgccggaccgtaccgccgcaaccgtcgcaacc
acctcggccgcgccgggccgcaccgccgcgaccacctcggcggagctgggccgcaccgca
gcccgccgggcgctgctggtcgagggtgacccggccgcgttggccgccccgctggtcgta
cagctgggcagcggctactcgatcgccgagggcaagctgccgtggggcctgcggccgttc
ctcggcgcggtcgagcagatcgacgtgaacgccgccgagaccagcgcggacgagctgatc
gcgcgcgccgcggggcggccgatcgtgctggtcgggcggcgggtgcatcaggcggcggcc
agccgggagctggccgagaagctggccgcggcctggcccgtggcggtggtggagatgggc
tggccgtcgacctggcgaccggacggggcacgcgccttcctggtcacccacggagccagc
ctggccagcgccgaggtcgccgccgccgccctgggtctgatcaccgaacgttacgacggc
gtgtag

DBGET integrated database retrieval system