KEGG   Actinoplanes sp. SE50/110: ACPL_7412Help
Entry
ACPL_7412         CDS       T02044                                 

Gene name
argI
Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ase01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ase00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8201559..8203523)
Genome map
AA seq 654 aa AA seqDB search
MRRIAVLDAPSNLGLRPPTPTSVPGCAKAPGALRDQGLLPRLGARDAGCLTPPRYDPGDW
RPGDGVAHAAEIAAYSRALADRIGAIIDGGEFPVVLGGDCSILIGSGLAMHRLGEAVGGR
IGLVFVDGHSDFRHPGNASYVGAAAGEDLALVTGRGQANLAAIESRRPYFRDIDVVVLGI
RAQDEYRLDLQAAGIVTRPVPMLRAEGAARSAQWARDQLVDCAGYWVHVDVDVLDPAVMP
AVDAPDPGGIAFPELELLLTGLVESPHCLGVEITVFDPDYDPDGRYAAEITSAVVSGLAP
VRTVTPRPDLIAARKDLANQPAAAPAARNESAPAVGSAVGAGVRAESASPAEDAAVVGAP
AFAEAVESAPAAELGPASGRAALAEPAGLAALAEPAGLAALAEPAGAAEAEASVIAPSVA
ERASDGFLAEISDSGAETGAEPERAGTPAEDPIDRDPAESTGEELSDGDPAAPVGGGLSD
GDPAGPVGGGLSDGDPAGPVGGGLSDEEPAASVDVGMSSDDAVAPVGGPSGDDAAIPVGE
ELPGEEPADAIGETLSDEELSEPGAASESESESESELENDKDGPVSVVPAAEKPVRPEIP
LLSRPLGSAPLLDSEPLPATRPGMLRPRTPADPPAVGAAAVPRPGFGPAIPPVY
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
gtgcgacgcatcgccgttctggacgcgccgtccaatctcggcctgcgcccgccgacgccc
acatcggtgccgggctgcgccaaggcgcccggcgccctccgcgaccaggggctgctgccc
cggctcggcgcccgcgacgccggctgcctcaccccgccccgatacgacccgggtgactgg
cgtcccggcgacggcgtcgcgcacgccgccgaaatcgcggcatactcgcgcgccctcgcc
gaccggatcggcgccatcatcgacggcggcgagttcccggtcgtgctcggcggcgactgc
tccatcctgatcggctccgggctggccatgcaccggctcggggaagccgtcggcggccgg
atcggcctcgtcttcgtggacggtcactccgacttccggcaccccggcaacgcgtcctac
gtgggcgccgccgccggcgaggacctcgccctggtcaccggccgcggccaggccaacctg
gcggcgatcgagagccgccgcccctacttccgcgacatcgacgtggtcgtcctcggcatc
cgcgcccaggacgaatatcgcctcgacctgcaagccgccggcatcgtcacccgcccggtc
ccgatgctgcgcgccgagggcgccgcccgcagcgcgcagtgggcccgcgaccagctcgtg
gactgcgcgggctactgggtgcacgtcgacgtcgacgtgctcgacccggcggtgatgccg
gcggtcgacgcaccggacccgggcgggatcgccttccccgaactcgaactgctactgacc
gggctcgtcgaatcaccgcactgcctcggcgtggagatcaccgtcttcgacccggactac
gacccggacggccgctacgccgcggagatcacctcagcggtggtgagcggcctggcgccg
gtccgcacggtgacgccgcggcccgacctgatcgccgcccgcaaggacctggccaaccag
cccgccgcggcgccggccgcgcggaatgagtcggcccctgccgtcgggtcggctgtgggg
gctggggtccgggcggagtcggcctctcccgctgaggacgccgccgtcgtgggggctccc
gcgtttgccgaggccgtcgaatctgctcccgccgcggagcttggcccggcttctgggcgt
gccgcgcttgcggagcccgccgggcttgccgcgcttgcggagcccgccgggcttgccgcg
cttgcggagcccgccggggctgccgaggcggaggcgtcggttatcgcgccgtcggtggct
gagcgggcctccgatggctttttagccgaaatttcggacagtggtgcggagaccggtgcg
gagcctgagcgggcgggaacccccgctgaggaccccatcgatcgcgacccagccgaatcg
accggcgaggagctgtccgacggcgacccggccgcgccggttggtggtgggctgtccgac
ggcgacccggccgggccggttggtggtgggctgtccgacggcgacccggccgggccggtt
ggtggtgggctgtccgatgaggagccggctgcatcggtagatgttgggatgtccagcgac
gatgcggtcgcgccggttggtgggccttccggtgacgatgcggcgataccggttggcgag
gagctgcccggcgaggagccggcagatgcgatcggcgagacgctgtccgacgaggagttg
agcgagccgggagctgcgtccgagtccgagtccgagtccgagtctgagcttgaaaacgat
aaggacggcccggtttcggtcgttcccgcggccgaaaaaccggtgcgacccgagatcccg
ctgctctcccggccgctgggctcggcgccgctgctcgactcggagccgctgccggccacc
aggcctggcatgctgcgcccccgcacccctgccgacccgcccgctgtcggcgccgccgcc
gtgccgcggccgggcttcggcccagcgatcccgccggtctactga

DBGET integrated database retrieval system