KEGG   Actinoplanes sp. SE50/110: ACPL_7568Help
Entry
ACPL_7568         CDS       T02044                                 

Definition
RNA polymerase sigma-E factor
Orthology
K03088  
RNA polymerase sigma-70 factor, ECF subfamily
Organism
ase  Actinoplanes sp. SE50/110
Brite
Transcription machinery [BR:ase03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     ACPL_7568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8366360..8367178)
Genome map
AA seq 272 aa AA seqDB search
MAEGVSVVRTGTERGMRERREATRVRELLDAPEWPATEPAPAAAPVSVSTPVFESVTGAL
PVSSAGRSRGESRVAQKERVDERRERFERDALPFVDQLYAAGLRMTRNPADAEDLVQETF
LKAFSAFHQFEEGTNLKAWLYRILTNTYINSYRRKQRQPLQSPTEEITDWQLASSESHTS
TGLRSAETEALDRLPDSDIKEALQSLPEDFRLAVYLADVEGFSYKEIADIMGTPIGTVMS
RLHRGRRNLRQLLVGYAADRGITRAASEPQEA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggggtgtcagtggtgcgtaccggtaccgagcgcgggatgcgcgagcgccgg
gaggcgacccgggtgcgggaacttctggatgctccggagtggccggccaccgagccggcg
cccgccgccgccccggtgagcgtgagcacaccggttttcgagagcgtgactggggcacta
cccgtatcctcggcggggcggtcgaggggggagtccagggtggcccagaaagagcgtgtc
gacgagcgtcgcgagcgcttcgagcgcgacgcgctgccgttcgtggatcagttgtacgcc
gccggcctgcgcatgacgcgcaatccggccgacgccgaggacctggtgcaggagacgttc
ctcaaggcgttctccgccttccaccagttcgaggagggcaccaacctcaaggcctggctg
taccggatcctgaccaacacctacatcaactcgtaccggcgcaagcagcggcagccgctg
cagtcgccgaccgaggagatcaccgactggcagctcgcctccagcgagtcgcacacctcg
accggactgcgctcggcggagaccgaggcgctcgaccggctcccggacagcgacatcaag
gaagcgctgcagtccctgccggaggacttccggctcgccgtctacctcgccgatgtcgag
ggtttctcgtacaaggagatcgccgacatcatgggcacgcccatcggcaccgtcatgtcc
cgcctgcaccgcggccggcgcaacctgcgccagctgctcgtcggatacgccgccgaccgg
ggcatcacccgggccgcgtccgagccgcaggaggcgtga

DBGET integrated database retrieval system