KEGG   Actinoplanes sp. SE50/110: ACPL_7581Help
Entry
ACPL_7581         CDS       T02044                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACPL_7581 (malQ)
Enzymes [BR:ase01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ACPL_7581 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8377724..8379640
Genome map
AA seq 638 aa AA seqDB search
MDARLEALAAAHGVATWYENYQRKRTEVAPESVIGVLGLLGVDAGDPAAVPEVTAPEVPG
TIVLREGQSRDLPAAAELTLEDGTTRTVDRLAGLPLGWHRLGDRTTVVVVPAELPKAPVT
WGWMLQLYALHSAESWGIGDLGDLRAFVSQCGDAGLVLLNPLHAITPVPPVPASPYSPSS
RRFANSLYLRIADTREYQRADVDVQKRIDALKPETGELIDYTAVWTAKLAALELLWPLAE
PVDLDADPGLTDFARFCALAEQHGPNWQTWPEELRHPGSPAVRAFRSDRIAFHAWVQHLV
EEQLDRAREAAAGMPVGIVHDLAVGIDPTGADGWLLQDSLAPGVRAGAPPDAFNQLGQDW
GLAAWRPDRLIATGYAAYRDMLRRIFRHAGGLRVDHVAGLWRLWWVPPGMGPAEGTYVHY
DPEAMLGILALEAQRAGAVVIGEDLGTVLPEMTETLERMNMLGSSVLWFTRDWDTGEFRP
AADYRRNALASISTHDLPTAAGFLAGEQVEVRARLGQLAGTVEQEWATWKADKAALLELL
RAEGLTGTDPTSEEVVLAMHEFLARTPCRLVTASLYDVLLERRQPNLPGTFDEYPNWRIP
LGPDLSEVVKDPIFRKVAGILGKRKAETGQRLTEGTTP
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgcgactcgaggcgctggccgcggcacacggggtggccacctggtacgagaac
taccagcgcaagcggaccgaggtggcccccgagtcggtgatcggggtgctgggcctgctc
ggcgtcgacgcgggcgacccggcggccgtgccggaggtcaccgcgccggaggtccccggg
accatcgtgctgcgcgaggggcagagccgggacctgccggcggccgccgagctcaccctg
gaggacgggaccacgcgcaccgtcgaccggctggccgggctgccgctgggctggcaccgg
ctcggcgaccgcaccaccgtcgtggtggtcccggccgagctgccgaaggcgccggtcacc
tggggctggatgctgcagctgtacgcgctgcactcggccgagtcgtggggcatcggcgac
ctgggcgacctgcgggccttcgtgtcccagtgcggggacgccgggctggtgctgctcaac
ccgctgcacgcgatcacgccggtgccgccggtgccggcctcgccgtactcgccgtccagc
cggcgcttcgcgaactcgctctacctgcggatcgcggacacccgggagtatcagcgcgcg
gatgtcgacgtacagaagcgcattgatgcccttaaaccggagaccggcgaactgatcgac
tacaccgcggtgtggaccgcgaaactcgccgccctggaactcctctggccgctcgcggag
cccgtcgacctggacgccgatccgggcctgacggatttcgcccgcttctgcgcactcgcc
gaacagcacggcccgaactggcagacctggccggaagagctgcgccaccccggctccccc
gcggtgcgggccttccgcagcgaccggatcgccttccacgcctgggtccagcacctggtc
gaggagcagctggaccgggcccgggaagcggccgccgggatgccggtcggcatcgtccac
gacctggccgtcggcatcgacccgaccggcgccgacggctggctgctgcaggactcgctg
gcacccggcgtccgggccggcgcgccgccggacgcgttcaaccagctcggccaggactgg
gggctggccgcctggcgcccggaccggctgatcgccaccggctacgccgcctatcgggac
atgctgcgccggatcttccggcacgccggcgggctgcgcgtcgaccacgtcgccgggctg
tggcggctgtggtgggtgccaccgggcatgggtccggccgagggcacctacgtgcactac
gacccggaggcgatgctcggcatcctggccctggaggcgcagcgcgccggcgccgtggtg
atcggtgaggacctgggcaccgtgctgccggagatgaccgagacgctggaacggatgaac
atgctcggctcgtccgtgctgtggttcacccgggactgggacaccggcgagttccggccc
gcggccgactaccggcgcaacgcgctggccagcatctccacccacgacctgccgaccgcc
gccgggttcctggccggcgagcaggtggaggtccgcgcccggctggggcagctggccggc
accgtcgagcaggagtgggcgacctggaaggcggacaaggccgcgctgctggagctgctg
cgcgccgagggcctgaccggcacggacccgaccagcgaggaggtggtgctggccatgcac
gagttcctggcccgcaccccgtgccggctggtcaccgcgtcgctctacgacgtgctgctg
gaacgtcggcagccgaacctgccgggaaccttcgacgagtaccccaactggcggatcccg
ctcggtccggacctgtccgaggtggtgaaggatccgatcttccgcaaggttgccgggatt
ctgggtaagcggaaggccgagacaggtcagagattgacggaagggaccacgccatga

DBGET integrated database retrieval system